• Gene id: 66035

Gene Summary

• Gene Symbol: SLC2A11   Gene   UCSC   Ensembl
• Aliases: GLUT10, GLUT11
• Gene name: solute carrier family 2 member 11
• Alternate names: solute carrier family 2, facilitated glucose transporter member 11, facilitative glucose transporter GLUT11, glucose transporter protein 10, glucose transporter protein 11, glucose transporter type 10, glucose transporter type 11, glucose transporter-like prote,
• Gene location: 22q11.23 (23856702: 23886311)     Exons: 14     NC_000022.11
• Gene summary(Entrez): This gene belongs to a family of proteins that mediate the transport of sugars across the cell membrane. The encoded protein transports glucose and fructose. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
• OMIM: 610367

Protein Summary

• Protein general information: Q9BYW1  
  • Name: Solute carrier family 2, facilitated glucose transporter member 11 (Glucose transporter type 11) (GLUT 11)
  • Length: 496  
  • Mass: 53703
  • Tissue specificity: Expressed in heart and skeletal muscle. {ECO
• Sequence:

  MRALRRLIQGRILLLTICAAGIGGTFQFGYNLSIINAPTLHIQEFTNETWQARTGEPLPDHLVLLMWSLIVSLYP
  LGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAGVSMNIQPMYLGESA
  PKELRGAVAMSSAIFTALGIVMGQVVGLRELLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLIDCGDTEA
  CLAALRRLRGSGDLAGELEELEEERAACQGCRARRPWELFQHRALRRQVTSLVVLGSAMELCGNDSVYAYASSVF
  RKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCWGSIFTVALCLQSSFPWTLYLAMAC
  IFAFILSFGIGPAGVTGILATELFDQMARPAACMVCGALMWIMLILVGLGFPFIMEALSHFLYVPFLGVCVCGAI
  YTGLFLPETKGKTFQEISKELHRLNFPRRAQGPTWRSLEVIQSTEL

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  IPR003663  IPR005829  
  • Prosite: PS50850 PS00217
  • STRING: ENSP00000483038
• Other Databases: GeneCards:  SLC2A11  Malacards:  SLC2A11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:1904659	glucose transmembrane transport	IDA	biological process
GO:0005355	glucose transmembrane transporter activity	IDA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008645	hexose transmembrane transport	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R