• Gene id: 66008

Gene Summary

• Gene Symbol: TRAK2   Gene   UCSC   Ensembl
• Aliases: ALS2CR3, CALS-C, GRIF-1, GRIF1, MILT2, OIP98
• Gene name: trafficking kinesin protein 2
• Alternate names: trafficking kinesin-binding protein 2, O-linked N-acetylglucosamine transferase interacting protein 98, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 3, amyotrophic lateral sclerosis 2 chromosomal region candidate gene 3 protein, gam,
• Gene location: 2q33.1 (107489768: 107484851)     Exons: 4     NC_000009.12
• OMIM: 607334

Protein Summary

• Protein general information: O60296  
  • Name: Trafficking kinesin binding protein 2 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 3 protein)
  • Length: 914  
  • Mass: 101419
  • Tissue specificity: Widely expressed, with highest expression in heart.
• Sequence:

  MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDTLFLYENQDWTQSPHQ
  RQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHVLSEQNESL
  EEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENM
  ALRSKACHIKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELIRYQEELSSLLSQIVDLQHKLKE
  HVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRSGPTAHLYFSQSYGAFTGESLA
  AEIEGTMRKKLSLDEESSLFKQKAQQKRVFDTVRIANDTRGRSISFPALLPIPGSNRSSVIMTAKPFESGLQQTE
  DKSLLNQGSSSEEVAGSSQKMGQPGPSGDSDLATALHRLSLRRQNYLSEKQFFAEEWQRKIQVLADQKEGVSGCV
  TPTESLASLCTTQSEITDLSSASCLRGFMPEKLQIVKPLEGSQTLYHWQQLAQPNLGTILDPRPGVITKGFTQLP
  GDAIYHISDLEEDEEEGITFQVQQPLEVEEKLSTSKPVTGIFLPPITSAGGPVTVATANPGKCLSCTNSTFTFTT
  CRILHPSDITQVTPSSGFPSLSCGSSGSSSSNTAVNSPALSYRLSIGESITNRRDSTTTFSSTMSLAKLLQERGI
  SAKVYHSPISENPLQPLPKSLAIPSTPPNSPSHSPCPSPLPFEPRVHLSENFLASRPAETFLQEMYGLRPSRNPP
  DVGQLKMNLVDRLKRLGIARVVKNPGAQENGRCQEAEIGPQKPDSAVYLNSGSSLLGGLRRNQSLPVIMGSFAAP
  VCTSSPKMGVLKED

• Structural information:
  • Protein Domains: (48..35-)
    (/note="HAP1-N-terminal")
  • Interpro: IPR006933  IPR022154  
  • STRING: ENSP00000328875
• Other Databases: GeneCards:  TRAK2  Malacards:  TRAK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050811	GABA receptor binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098957	anterograde axonal transport of mitochondrion	IBA	biological process
GO:0050811	GABA receptor binding	IBA	molecular function
GO:0047496	vesicle transport along microtubule	IBA	biological process
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0022008	neurogenesis	IBA	biological process
GO:0006605	protein targeting	IBA	biological process
GO:0048311	mitochondrion distribution	IBA	biological process
GO:0017022	myosin binding	IBA	molecular function
GO:0008104	protein localization	IBA	biological process
GO:0008089	anterograde axonal transport	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005739	mitochondrion	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0098972	anterograde dendritic transport of mitochondrion	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006605	protein targeting	IEA	biological process
GO:0008333	endosome to lysosome transport	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030911	TPR domain binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0044295	axonal growth cone	IEA	cellular component
GO:0048813	dendrite morphogenesis	IEA	biological process
GO:0050771	negative regulation of axonogenesis	IEA	biological process
GO:0050811	GABA receptor binding	IEA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006493	protein O-linked glycosylation	IEA	biological process
GO:0019894	kinesin binding	IEA	molecular function
GO:0019899	enzyme binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0098939	dendritic transport of mitochondrion	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:0032839	dendrite cytoplasm	IEA	cellular component
GO:0032839	dendrite cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005102	signaling receptor binding	ISS	molecular function
GO:0005886	plasma membrane	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04727	GABAergic synapse

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray