• Gene id: 66005

Gene Summary

• Gene Symbol: CHID1   Gene   UCSC   Ensembl
• Aliases: GL008, SI-CLP, SICLP
• Gene name: chitinase domain containing 1
• Alternate names: chitinase domain-containing protein 1, stabilin-1 interacting chitinase-like protein,
• Gene location: 11p15.5 (915057: 867858)     Exons: 19     NC_000011.10

Protein Summary

• Protein general information: Q9BWS9  
  • Name: Chitinase domain containing protein 1 (Stabilin 1 interacting chitinase like protein) (SI CLP)
  • Length: 393  
  • Mass: 44941
  • Tissue specificity: Expressed in cells of monocytic, T, B and epithelial origin. {ECO
• Sequence:

  MRTLFNLLWLALACSPVHTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDR
  HFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPVWLQLKRRGREMFEVTGLHDVDQGWMRAVRKHAKGLHIVPRL
  LFEDWTYDDFRNVLDSEDEIEELSKTVVQVAKNQHFDGFVVEVWNQLLSQKRVGLIHMLTHLAEALHQARLLALL
  VIPPAITPGTDQLGMFTHKEFEQLAPVLDGFSLMTYDYSTAHQPGPNAPLSWVRACVQVLDPKSKWRSKILLGLN
  FYGMDYATSKDAREPVVGARYIQTLKDHRPRMVWDSQASEHFFEYKKSRSGRHVVFYPTLKSLQVRLELARELGV
  GVSIWELGQGLDYFYDLL

• Structural information:
  • Protein Domains: (79..39-)
    (/note="GH18-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01258"-)
  • Interpro: IPR011583  IPR029070  IPR001223  IPR017853  
  • Prosite: PS51910
  • PDB: 3BXW
  • PDBsum: 3BXW
  • STRING: ENSP00000398722
• Other Databases: GeneCards:  CHID1  Malacards:  CHID1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070492	oligosaccharide binding	IBA	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008061	chitin binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0002576	platelet degranulation	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:1900016	negative regulation of cytokine production involved in inflammatory response	IDA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0070492	oligosaccharide binding	IPI	molecular function
GO:0070492	oligosaccharide binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq