• Gene id: 66002

Gene Summary

• Gene Symbol: CYP4F12   Gene   UCSC   Ensembl
• Aliases: CYPIVF12, F22329_1
• Gene name: cytochrome P450 family 4 subfamily F member 12
• Alternate names: cytochrome P450 4F12, cytochrome P450, family 4, subfamily F, polypeptide 12, cytochrome P450, subfamily IVF, polypeptide 12,
• Gene location: 19p13.12 (15673022: 15698818)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein likel
• OMIM: 611355

Protein Summary

• Protein general information: Q9HCS2  
  • Name: Cytochrome P450 4F12 (EC 1.14.14.1) (CYPIVF12)
  • Length: 524  
  • Mass: 60309
  • Tissue specificity: Expressed in small intestine, liver, colon and heart. {ECO
• Sequence:

  MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWFWGHLGLITPTEEGLK
  NSTQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSGGDKWSRHRRM
  LTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSRLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATI
  LELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFID
  VLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWDDL
  AQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPENS
  KGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000448998
• Other Databases: GeneCards:  CYP4F12  Malacards:  CYP4F12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0050051	leukotriene-B4 20-monooxygenase activity	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0042376	phylloquinone catabolic process	IBA	biological process
GO:0042361	menaquinone catabolic process	IBA	biological process
GO:0008391	arachidonic acid monooxygenase activity	IBA	molecular function
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0042377	vitamin K catabolic process	IBA	biological process
GO:0036101	leukotriene B4 catabolic process	IBA	biological process
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0070330	aromatase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0019369	arachidonic acid metabolic process	ISS	biological process
GO:0018685	alkane 1-monooxygenase activity	ISS	molecular function
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0050051	leukotriene-B4 20-monooxygenase activity	ISS	molecular function
GO:0008392	arachidonic acid epoxygenase activity	ISS	molecular function
GO:0001676	long-chain fatty acid metabolic process	ISS	biological process
GO:0055078	sodium ion homeostasis	ISS	biological process
GO:0042360	vitamin E metabolic process	ISS	biological process
GO:0036101	leukotriene B4 catabolic process	ISS	biological process
GO:0019373	epoxygenase P450 pathway	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0003095	pressure natriuresis	ISS	biological process
GO:0003091	renal water homeostasis	ISS	biological process
GO:0055114	oxidation-reduction process	ISS	biological process
GO:0043231	intracellular membrane-bounded organelle	ISS	cellular component
GO:0017144	drug metabolic process	ISS	biological process
GO:0000038	very long-chain fatty acid metabolic process	ISS	biological process
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0050051	leukotriene-B4 20-monooxygenase activity	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0042376	phylloquinone catabolic process	IBA	biological process
GO:0042361	menaquinone catabolic process	IBA	biological process
GO:0008391	arachidonic acid monooxygenase activity	IBA	molecular function
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0042377	vitamin K catabolic process	IBA	biological process
GO:0036101	leukotriene B4 catabolic process	IBA	biological process
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0070330	aromatase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0019369	arachidonic acid metabolic process	ISS	biological process
GO:0018685	alkane 1-monooxygenase activity	ISS	molecular function
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0050051	leukotriene-B4 20-monooxygenase activity	ISS	molecular function
GO:0008392	arachidonic acid epoxygenase activity	ISS	molecular function
GO:0001676	long-chain fatty acid metabolic process	ISS	biological process
GO:0055078	sodium ion homeostasis	ISS	biological process
GO:0042360	vitamin E metabolic process	ISS	biological process
GO:0036101	leukotriene B4 catabolic process	ISS	biological process
GO:0019373	epoxygenase P450 pathway	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0003095	pressure natriuresis	ISS	biological process
GO:0003091	renal water homeostasis	ISS	biological process
GO:0055114	oxidation-reduction process	ISS	biological process
GO:0043231	intracellular membrane-bounded organelle	ISS	cellular component
GO:0017144	drug metabolic process	ISS	biological process
GO:0000038	very long-chain fatty acid metabolic process	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881