• Gene id: 66000

Gene Summary

• Gene Symbol: TMEM108   Gene   UCSC   Ensembl
• Aliases: CT124, RTLN
• Gene name: transmembrane protein 108
• Alternate names: transmembrane protein 108, cancer/testis antigen 124, retrolinkin,
• Gene location: 3q22.1 (133038287: 133397774)     Exons: 4     NC_000003.12
• OMIM: 617361

Protein Summary

• Protein general information: Q6UXF1  
  • Name: Transmembrane protein 108 (Retrolinkin)
  • Length: 575  
  • Mass: 59948
• Sequence:

  MKRSLQALYCQLLSFLLILALTEALAFAIQEPSPRESLQVLPSGTPPGTMVTAPHSSTRHTSVVMLTPNPDGPPS
  QAAAPMATPTPRAEGHPPTHTISTIAATVTAPHSESSLSTGPAPAAMATTSSKPEGRPRGQAAPTILLTKPPGAT
  SRPTTAPPRTTTRRPPRPPGSSRKGAGNSSRPVPPAPGGHSRSKEGQRGRNPSSTPLGQKRPLGKIFQIYKGNFT
  GSVEPEPSTLTPRTPLWGYSSSPQPQTVAATTVPSNTSWAPTTTSLGPAKDKPGLRRAAQGGGSTFTSQGGTPDA
  TAASGAPVSPQAAPVPSQRPHHGDPQDGPSHSDSWLTVTPGTSRPLSTSSGVFTAATGPTPAAFDTSVSAPSQGI
  PQGASTTPQAPTHPSRVSESTISGAKEETVATLTMTDRVPSPLSTVVSTATGNFLNRLVPAGTWKPGTAGNISHV
  AEGDKPQHRATICLSKMDIAWVILAISVPISSCSVLLTVCCMKRKKKTANPENNLSYWNNTITMDYFNRHAVELP
  REIQSLETSEDQLSEPRSPANGDYRDTGMVLVNPFCQETLFVGNDQVSEI

• Structural information:
  • Interpro: IPR031508  
  • Prosite: PS00430
  • STRING: ENSP00000324651
• Other Databases: GeneCards:  TMEM108  Malacards:  TMEM108

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097106	postsynaptic density organization	IBA	biological process
GO:0030424	axon	IBA	cellular component
GO:0008090	retrograde axonal transport	IBA	biological process
GO:0097484	dendrite extension	IBA	biological process
GO:0014069	postsynaptic density	IBA	cellular component
GO:0010008	endosome membrane	IBA	cellular component
GO:0005769	early endosome	IBA	cellular component
GO:0097106	postsynaptic density organization	ISS	biological process
GO:0021542	dentate gyrus development	ISS	biological process
GO:1990416	cellular response to brain-derived neurotrophic factor stimulus	ISS	biological process
GO:0031175	neuron projection development	ISS	biological process
GO:0030424	axon	ISS	cellular component
GO:0008090	retrograde axonal transport	ISS	biological process
GO:0036477	somatodendritic compartment	ISS	cellular component
GO:0098815	modulation of excitatory postsynaptic potential	ISS	biological process
GO:0051388	positive regulation of neurotrophin TRK receptor signaling pathway	ISS	biological process
GO:0005769	early endosome	ISS	cellular component
GO:0097484	dendrite extension	ISS	biological process
GO:0006898	receptor-mediated endocytosis	ISS	biological process
GO:0010008	endosome membrane	ISS	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008090	retrograde axonal transport	IEA	biological process
GO:0021542	dentate gyrus development	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0031175	neuron projection development	IEA	biological process
GO:0036477	somatodendritic compartment	IEA	cellular component
GO:0097106	postsynaptic density organization	IEA	biological process
GO:1990416	cellular response to brain-derived neurotrophic factor stimulus	IEA	biological process
GO:0005769	early endosome	IEA	cellular component
GO:0006898	receptor-mediated endocytosis	IEA	biological process
GO:0010008	endosome membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0051388	positive regulation of neurotrophin TRK receptor signaling pathway	IEA	biological process
GO:0097484	dendrite extension	IEA	biological process
GO:0098815	modulation of excitatory postsynaptic potential	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq