• Gene id: 65991

Gene Summary

• Gene Symbol: FUNDC2   Gene   UCSC   Ensembl
• Aliases: DC44, HCBP6, HCC3, PD03104
• Gene name: FUN14 domain containing 2
• Alternate names: FUN14 domain-containing protein 2, HCC-3, cervical cancer oncogene 3, cervical cancer proto-oncogene 3 protein, hepatitis C virus core-binding protein 6,
• Gene location: Xq28 (155026843: 155060303)     Exons: 5     NC_000023.11
• OMIM: 301042

Protein Summary

• Protein general information: Q9BWH2  
  • Name: FUN14 domain containing protein 2 (Cervical cancer proto oncogene 3 protein) (HCC 3) (Hepatitis C virus core binding protein 6)
  • Length: 189  
  • Mass: 20676
• Sequence:

  METSAPRAGSQVVATTARHSAAYRADPLRVSSRDKLTEMAASSQGNFEGNFESLDLAEFAKKQPWWRKLFGQESG
  PSAEKYSVATQLFIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHTGYIKVDWQRVEKDMKKAKEQLKIRK
  SNQIPTEVRSKAEEVVSFVKKNVLVTGGFFGGFLLGMAS

• Structural information:
  • Interpro: IPR007014  
  • STRING: ENSP00000358510
• Other Databases: GeneCards:  FUNDC2  Malacards:  FUNDC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031307	integral component of mitochondrial outer membrane	IBA	cellular component
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray