• Gene id: 65990

Gene Summary

• Gene Symbol: ANTKMT   Gene   UCSC   Ensembl
• Aliases: ANT-KMT, C16orf24, FAM173A
• Gene name: adenine nucleotide translocase lysine methyltransferase
• Alternate names: adenine nucleotide translocase lysine N-methyltransferase, family with sequence similarity 173 member A, protein FAM173A, protein N-lysine methyltransferase FAM173A,
• Gene location: 16p13.3 (720580: 722589)     Exons: 3     NC_000016.10
• OMIM: 618566

Protein Summary

• Protein general information: Q9BQD7  
  • Name: Adenine nucleotide translocase lysine N methyltransferase (ANT KMT) (EC 2.1.1. )
  • Length: 235  
  • Mass: 25130
• Sequence:

  MEQDDPVEALTELRERRLGALELLQAAAGSGLAAYAVWALLLQPGFRRVPLRLQVPYVGASARQVEHVLSLLRGR
  PGKTVDLGSGDGRIVLAAHRCGLRPAVGYELNPWLVALARLHAWRAGCAGSVCYRRKDLWKVSLRDCRNVSVFLA
  PSVLPLLEDKLRTELPAGARVVSGRFPLPTWQPVTAVGEGLDRVWAYDVPEGGQAGEAASSRIPIQAAPGPSSAP
  IPGGLISQAS

• Structural information:
  • Interpro: IPR026170  IPR029063  
  • STRING: ENSP00000454380
• Other Databases: GeneCards:  ANTKMT  Malacards:  ANTKMT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018023	peptidyl-lysine trimethylation	IDA	biological process
GO:0016279	protein-lysine N-methyltransferase activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0016279	protein-lysine N-methyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031966	mitochondrial membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq