• Gene id: 65989

Gene Summary

• Gene Symbol: DLK2   Gene   UCSC   Ensembl
• Aliases: DLK-2, EGFL9
• Gene name: delta like non-canonical Notch ligand 2
• Alternate names: protein delta homolog 2, EGF-like protein 9, EGF-like-domain, multiple 9, delta-like 2 homolog, epidermal growth factor-like protein 9,
• Gene location: 6p21.1 (43456631: 43450351)     Exons: 7     NC_000006.12

Protein Summary

• Protein general information: Q6UY11  
  • Name: Protein delta homolog 2 (DLK 2) (Epidermal growth factor like protein 9) (EGF like protein 9)
  • Length: 383  
  • Mass: 40548
• Sequence:

  MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPW
  QCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQD
  DQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGA
  RCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEA
  GLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQVSMLPAGLPLPRDLPP
  EPGKTTAL

• Structural information:
  • Protein Domains: (27..5-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (62..8-)
    (/note="EGF-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (91..12-)
    (/note="EGF-like-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0-)
  • Interpro: IPR001881  IPR013032  IPR000742  IPR000152  IPR018097  
  • Prosite: PS00010 PS00022 PS01186 PS50026 PS01187
  • STRING: ENSP00000349893
• Other Databases: GeneCards:  DLK2  Malacards:  DLK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045746	negative regulation of Notch signaling pathway	IBA	biological process
GO:0007219	Notch signaling pathway	IBA	biological process
GO:0005112	Notch binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045746	negative regulation of Notch signaling pathway	IDA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IEA	biological process
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881