• Gene id: 65981

Gene Summary

• Gene Symbol: CAPRIN2   Gene   UCSC   Ensembl
• Aliases: C1QDC1, EEG-1, EEG1, RNG140
• Gene name: caprin family member 2
• Alternate names: caprin-2, C1q domain-containing protein 1, RNA granule protein 140, cytoplasmic activation/proliferation-associated protein 2, gastric cancer multidrug resistance-associated protein,
• Gene location: 12p11.21 (30754992: 30709551)     Exons: 20     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene may regulate the transport of mRNA. It may play a role in the differentiation of erythroblasts. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

Protein Summary

• Protein general information: Q6IMN6  
  • Name: Caprin 2 (C1q domain containing protein 1) (Cytoplasmic activation/proliferation associated protein 2) (Gastric cancer multidrug resistance associated protein) (Protein EEG 1) (RNA granule protein 140)
  • Length: 1127  
  • Mass: 125925
  • Tissue specificity: Detected in all tissues tested with highest levels of expression in brain and spleen. {ECO
• Sequence:

  MEVQVSQASLGFELTSVEKSLREWSRLSREVIAWLCPSSPNFILNFPPPPSASSVSMVQLFSSPFGYQSPSGHSE
  EEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASPSQAYETYIENGLICLKHKIRNIEKKKLKLEDYKDRL
  KSGEHLNPDQLEAVEKYEEVLHNLEFAKELQKTFSGLSLDLLKAQKKAQRREHMLKLEAEKKKLRTILQVQYVLQ
  NLTQEHVQKDFKGGLNGAVYLPSKELDYLIKFSKLTCPERNESLSVEDQMEQSSLYFWDLLEGSEKAVVGTTYKH
  LKDLLSKLLNSGYFESIPVPKNAKEKEVPLEEEMLIQSEKKTQLSKTESVKESESLMEFAQPEIQPQEFLNRRYM
  TEVDYSNKQGEEQPWEADYARKPNLPKRWDMLTEPDGQEKKQESFKSWEASGKHQEVSKPAVSLEQRKQDTSKLR
  STLPEEQKKQEISKSKPSPSQWKQDTPKSKAGYVQEEQKKQETPKLWPVQLQKEQDPKKQTPKSWTPSMQSEQNT
  TKSWTTPMCEEQDSKQPETPKSWENNVESQKHSLTSQSQISPKSWGVATASLIPNDQLLPRKLNTEPKDVPKPVH
  QPVGSSSTLPKDPVLRKEKLQDLMTQIQGTCNFMQESVLDFDKPSSAIPTSQPPSATPGSPVASKEQNLSSQSDF
  LQEPLQATSSPVTCSSNACLVTTDQASSGSETEFMTSETPEAAIPPGKQPSSLASPNPPMAKGSEQGFQSPPASS
  SSVTINTAPFQAMQTVFNVNAPLPPRKEQEIKESPYSPGYNQSFTTASTQTPPQCQLPSIHVEQTVHSQETAANY
  HPDGTIQVSNGSLAFYPAQTNVFPRPTQPFVNSRGSVRGCTRGGRLITNSYRSPGGYKGFDTYRGLPSISNGNYS
  QLQFQAREYSGAPYSQRDNFQQCYKRGGTSGGPRANSRAGWSDSSQVSSPERDNETFNSGDSGQGDSRSMTPVDV
  PVTNPAATILPVHVYPLPQQMRVAFSAARTSNLAPGTLDQPIVFDLLLNNLGETFDLQLGRFNCPVNGTYVFIFH
  MLKLAVNVPLYVNLMKNEEVLVSAYANDGAPDHETASNHAILQLFQGDQIWLRLHRGAIYGSSWKYSTFSGYLLY
  QD

• Structural information:
  • Protein Domains: (993..112-)
    (/note="C1q-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00368"-)
  • Interpro: IPR001073  IPR028816  IPR022070  IPR041637  IPR008983  
  • Prosite: PS50871
  • PDB: 4OUL 4OUM 5J97
  • PDBsum: 4OUL 4OUM 5J97
  • STRING: ENSP00000298892
• Other Databases: GeneCards:  CAPRIN2  Malacards:  CAPRIN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061003	positive regulation of dendritic spine morphogenesis	ISS	biological process
GO:0050775	positive regulation of dendrite morphogenesis	ISS	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0017148	negative regulation of translation	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061003	positive regulation of dendritic spine morphogenesis	IEA	biological process
GO:0050775	positive regulation of dendrite morphogenesis	IEA	biological process
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0032092	positive regulation of protein binding	IDA	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0030308	negative regulation of cell growth	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881