• Gene id: 65980

Gene Summary

• Gene Symbol: BRD9   Gene   UCSC   Ensembl
• Aliases: LAVS3040, PRO9856
• Gene name: bromodomain containing 9
• Alternate names: bromodomain-containing protein 9, rhabdomyosarcoma antigen MU-RMS-40.8, sarcoma antigen NY-SAR-29,
• Gene location: 5p15.33 (892802: 863734)     Exons: 23     NC_000005.10
• OMIM: 618465

Protein Summary

• Protein general information: Q9H8M2  
  • Name: Bromodomain containing protein 9 (Rhabdomyosarcoma antigen MU RMS 40.8)
  • Length: 597  
  • Mass: 67000
• Sequence:

  MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHERERHKEKKKKKKKKSE
  KEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEPPPDRPVRACRTQPAENESTPIQQLLEHFLR
  QLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKL
  AKKILHAGFKMMSKQAALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
  ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDE
  RRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQCALSLQEFVKDAGSYSKKVVDDLLDQITGG
  DHSRTLFQLKQRRNVPMKPPDEAKVGDTLGDSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLD
  ETTKLLQDLHEAQAERGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT

• Structural information:
  • Protein Domains: (153..22-)
    (/note="Bromo-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00035"-)
  • Interpro: IPR001487  IPR036427  IPR021900  
  • Prosite: PS50014
  • PDB: 3HME 4NQN 4UIT 4UIU 4UIV 4UIW 4XY8 4YY4 4YY6 4YYD 4YYG 4YYH 4YYI 4YYJ 4YYK 4Z6H 4Z6I 5E9V 5EU1 5F1H 5F1L 5F25 5F2P 5I40 5I7X 5I7Y 5IGM 5IGN 5JI8 5MKY 5TWX 6BQA 6HM0
  • PDBsum: 3HME 4NQN 4UIT 4UIU 4UIV 4UIW 4XY8 4YY4 4YY6 4YYD 4YYG 4YYH 4YYI 4YYJ 4YYK 4Z6H 4Z6I 5E9V 5EU1 5F1H 5F1L 5F25 5F2P 5I40 5I7X 5I7Y 5IGM 5IGN 5JI8 5MKY 5TWX 6BQA 6HM0
  • STRING: ENSP00000419765
• Other Databases: GeneCards:  BRD9  Malacards:  BRD9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070577	lysine-acetylated histone binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0016514	SWI/SNF complex	IDA	cellular component
GO:0070577	lysine-acetylated histone binding	IDA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	NAS	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray