• Gene id: 6590

Gene Summary

• Gene Symbol: SLPI   Gene   UCSC   Ensembl
• Aliases: ALK1, ALP, BLPI, HUSI, HUSI-I, MPI, WAP4, WFDC4
• Gene name: secretory leukocyte peptidase inhibitor
• Alternate names: antileukoproteinase, HUSI-1, WAP four-disulfide core domain protein 4, mucus proteinase inhibitor, protease inhibitor WAP4, secretory leukocyte protease inhibitor (antileukoproteinase), seminal proteinase inhibitor,
• Gene location: 20q13.12 (45254563: 45252238)     Exons: 4     NC_000020.11
• Gene summary(Entrez): This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cat
• OMIM: 107285

Protein Summary

• Protein general information: P03973  
  • Name: Antileukoproteinase (ALP) (BLPI) (HUSI 1) (Mucus proteinase inhibitor) (MPI) (Protease inhibitor WAP4) (Secretory leukocyte protease inhibitor) (Seminal proteinase inhibitor) (WAP four disulfide core domain protein 4)
  • Length: 132  
  • Mass: 14,326
• Sequence:

  MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDP
  VDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA

• Structural information:
  • Protein Domains: WAP (28-76)
    WAP (82-130)
  • Interpro: IPR036645  IPR008197  
  • Prosite: PS51390
  • PDB: 2Z7F 4DOQ
  • PDBsum: 2Z7F 4DOQ
  • STRING: ENSP00000342082
• Other Databases: GeneCards:  SLPI  Malacards:  SLPI

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006955	immune response	ISS	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0019731	antibacterial humoral response	ISS	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045087	innate immune response	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0004866	endopeptidase inhibitor activity	IEA	molecular function
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006955	immune response	IEA	biological process
GO:0006955	immune response	ISS	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0019731	antibacterial humoral response	IEA	biological process
GO:0019731	antibacterial humoral response	ISS	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045087	innate immune response	ISS	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0006955	immune response	ISS	biological process
GO:0019731	antibacterial humoral response	ISS	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045087	innate immune response	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component

Diseases

Associated diseases	References
Endometriosis	INFBASE: 2311256
Endometriosis	INFBASE: 10956555
Female infertility	INFBASE: 2311256
Sperm motility	MIK: 9809675
Leukocytospermia	MIK: 9809675
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Leukospermia	MIK: 9809675
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
9809675	Sperm motility, leukospermia				Male infertility	SLPI
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray