• Gene id: 6588

Gene Summary

• Gene Symbol: SLN   Gene   UCSC   Ensembl
• Gene name: sarcolipin
• Alternate names: sarcolipin,
• Gene location: 11q22.3 (107712055: 107707377)     Exons: 2     NC_000011.10
• Gene summary(Entrez): Sarcoplasmic reticulum Ca(2+)-ATPases are transmembrane proteins that catalyze the ATP-dependent transport of Ca(2+) from the cytosol into the lumen of the sarcoplasmic reticulum in muscle cells. This gene encodes a small proteolipid that regulates severa
• OMIM: 602203

Protein Summary

• Protein general information: O00631  
  • Name: Sarcolipin
  • Length: 31  
  • Mass: 3762
• Sequence:

  MGINTRELFLNFTIVLITVILMWLLVRSYQY

• Structural information:
  • Interpro: IPR008028  
  • PDB: 1JDM
  • PDBsum: 1JDM
  • DIP: 61731
  • STRING: ENSP00000435380
• Other Databases: GeneCards:  SLN  Malacards:  SLN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901894	regulation of ATPase-coupled calcium transmembrane transporter activity	IDA	biological process
GO:0033017	sarcoplasmic reticulum membrane	ISS	cellular component
GO:0070296	sarcoplasmic reticulum calcium ion transport	ISS	biological process
GO:1901077	regulation of relaxation of muscle	ISS	biological process
GO:0030234	enzyme regulator activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004857	enzyme inhibitor activity	ISS	molecular function
GO:0051117	ATPase binding	ISS	molecular function
GO:0043086	negative regulation of catalytic activity	ISS	biological process
GO:1901877	negative regulation of calcium ion binding	ISS	biological process
GO:0043242	negative regulation of protein-containing complex disassembly	ISS	biological process
GO:0090281	negative regulation of calcium ion import	ISS	biological process
GO:1901020	negative regulation of calcium ion transmembrane transporter activity	ISS	biological process
GO:1901881	positive regulation of protein depolymerization	ISS	biological process
GO:0033017	sarcoplasmic reticulum membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0016529	sarcoplasmic reticulum	IDA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0051924	regulation of calcium ion transport	ISS	biological process
GO:0006816	calcium ion transport	NAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)