• Gene id: 6585

Gene Summary

• Gene Symbol: SLIT1   Gene   UCSC   Ensembl
• Aliases: MEGF4, SLIL1, SLIT-1, SLIT3
• Gene name: slit guidance ligand 1
• Alternate names: slit homolog 1 protein, multiple EGF-like domains protein 4, multiple epidermal growth factor-like domains protein 4, slit homolog 1,
• Gene location: 10q24.1 (127735327: 127731523)     Exons: 5     NC_000009.12
• OMIM: 603742

SNPs

rs3743104

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.32731784A>C
NC_000015.10   g.32731784A>G
NC_000015.10   g.32731784A>T
NC_000015.9   g.33023985A>C
NC_000015.9   g.33023985A>G
NC_000015.9   g.33023985A>T
NG_033791.1   g.18781A>C
NG_033791.1   g.18781A>G
NG_033791.1   g.18781A>T
NG_033791.2   g.18781A>C

Protein Summary

• Protein general information: O75093  
  • Name: Slit homolog 1 protein (Slit 1) (Multiple epidermal growth factor like domains protein 4) (Multiple EGF like domains protein 4)
  • Length: 1534  
  • Mass: 167926
  • Tissue specificity: Predominantly expressed in adult forebrain. Expressed in fetal brain, lung and kidney. {ECO
• Sequence:

  MALTPGWGSSAGPVRPELWLLLWAAAWRLGASACPALCTCTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITR
  IHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHMLPELLFQNNQALSRLDLSENAIQAIPR
  KAFRGATDLKNLQLDKNQISCIEEGAFRALRGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAW
  LSQWLRQRPTIGLFTQCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSNGIVDCRGKGL
  TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRG
  VFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWL
  ADFLRTNPIETSGARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVCPHKCRCEANVVE
  CSSLKLTKIPERIPQSTAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQ
  LESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTLQSLSTLNLLANPFNC
  NCQLAWLGGWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCEEGQEEGGCLPRPQCPQECACLDTVVRCSNK
  HLRALPKGIPKNVTELYLDGNQFTLVPGQLSTFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPP
  LAFQGLRSLRLLSLHGNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPQDME
  GKLLLTTPAKKFECQGPPTLAVQAKCDLCLSSPCQNQGTCHNDPLEVYRCACPSGYKGRDCEVSLDSCSSGPCEN
  GGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACANGGVCVDGVGNYTCQCPLQYEGKACEQLVDLCSPD
  LNPCQHEAQCVGTPDGPRCECMPGYAGDNCSENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLP
  APKSPCEGTECQNGANCVDQGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDN
  GILLYNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAETINDGQFHTVELVAFDQMVNLSIDGGSPMTMDNFGK
  HYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYINNELQDFTKTQMKPGVVPGCEPCRKLYCLHG
  ICQPNATPGPMCHCEAGWVGLHCDQPADGPCHGHKCVHGQCVPLDALSYSCQCQDGYSGALCNQAGALAEPCRGL
  QCLHGHCQASGTKGAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVECRGSCPGQGCCQG
  LRLKRRKFTFECSDGTSFAEEVEKPTKCGCALCA

• Structural information:
  • Protein Domains: (34..6-)
    (/note="LRRNT-)
    (215..26-)
    (/note="LRRCT-1)
    (273..30-)
    (/note="LRRNT-2)
    (439..48-)
    (/note="LRRCT-2)
    (504..54-)
    (/note="LRRNT-3)
    (671..72-)
    (/note="LRRCT-3)
    (725..76-)
    (/note="LRRNT-4)
    (866..91-)
  • Interpro: IPR013320  IPR000483  IPR006207  IPR001881  IPR013032   IPR000742  IPR000152  IPR018097  IPR003645  IPR009030  IPR001791  IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS01185 PS01225 PS00022 PS01186 PS50026 PS01187 PS50025 PS51450
  • STRING: ENSP00000266058
• Other Databases: GeneCards:  SLIT1  Malacards:  SLIT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0007411	axon guidance	IBA	biological process
GO:0008201	heparin binding	IBA	molecular function
GO:0048495	Roundabout binding	IBA	molecular function
GO:0050919	negative chemotaxis	IBA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033563	dorsal/ventral axon guidance	IEA	biological process
GO:0031290	retinal ganglion cell axon guidance	IEA	biological process
GO:0021772	olfactory bulb development	IEA	biological process
GO:0007097	nuclear migration	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0050919	negative chemotaxis	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0048495	Roundabout binding	IEA	molecular function
GO:0022029	telencephalon cell migration	IEA	biological process
GO:0022028	tangential migration from the subventricular zone to the olfactory bulb	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0021834	chemorepulsion involved in embryonic olfactory bulb interneuron precursor migration	IDA	NOT|biological process
GO:0007411	axon guidance	IDA	biological process
GO:0048846	axon extension involved in axon guidance	IDA	biological process
GO:0050919	negative chemotaxis	IDA	biological process
GO:0005615	extracellular space	NAS	cellular component
GO:0005509	calcium ion binding	NAS	molecular function
GO:0048853	forebrain morphogenesis	NAS	biological process
GO:0048495	Roundabout binding	IPI	molecular function
GO:0048495	Roundabout binding	IPI	molecular function
GO:0051964	negative regulation of synapse assembly	ISS	biological process
GO:0008045	motor neuron axon guidance	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq