• Gene id: 6582

Gene Summary

• Gene Symbol: SLC22A2   Gene   UCSC   Ensembl
• Aliases: OCT2
• Gene name: solute carrier family 22 member 2
• Alternate names: solute carrier family 22 member 2, organic cation transporter 2, solute carrier family 22 (organic cation transporter), member 2,
• Gene location: 6q25.3 (160258820: 160216754)     Exons: 11     NC_000006.12
• Gene summary(Entrez): Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c
• OMIM: 602608

Protein Summary

• Protein general information: O15244  
  • Name: Solute carrier family 22 member 2 (Organic cation transporter 2) (hOCT2)
  • Length: 555  
  • Mass: 62581
  • Tissue specificity: Mainly expressed in kidney. Localized at the luminal membrane and basolateral membrane of kidney distal tubule and proximal tubules. To a lower extent, expressed in neurons of the cerebral cortex and in various subcortical nuclei (at p
• Sequence:

  MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELSLRCGWSPAEELNYTV
  PGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFNLVCANSWMLD
  LFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILI
  TEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAYALPHWRWLQFTVSLPNFFFLLYYWCIPESPRWLISQNKNAEAM
  RIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSVLYQGLIMHMGLAGDN
  IYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLASVFIPGDLQWLKIIISCLGRMGITMAYEIV
  CLVNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPET
  IEEAENMQRPRKNKEKMIYLQVQKLDIPLN

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  IPR004749  IPR005829  
  • Prosite: PS50850 PS00216
  • STRING: ENSP00000355920
• Other Databases: GeneCards:  SLC22A2  Malacards:  SLC22A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006836	neurotransmitter transport	IDA	biological process
GO:0140115	export across plasma membrane	IDA	biological process
GO:0005275	amine transmembrane transporter activity	IDA	molecular function
GO:0005326	neurotransmitter transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0042908	xenobiotic transport	IDA	biological process
GO:0042908	xenobiotic transport	IDA	biological process
GO:0008504	monoamine transmembrane transporter activity	IDA	molecular function
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0019534	toxin transmembrane transporter activity	IDA	molecular function
GO:0019534	toxin transmembrane transporter activity	IDA	molecular function
GO:0015101	organic cation transmembrane transporter activity	IDA	molecular function
GO:0015101	organic cation transmembrane transporter activity	IDA	molecular function
GO:0015562	efflux transmembrane transporter activity	IDA	molecular function
GO:0015220	choline transmembrane transporter activity	IDA	molecular function
GO:0042910	xenobiotic transmembrane transporter activity	IDA	molecular function
GO:0042910	xenobiotic transmembrane transporter activity	IDA	molecular function
GO:1901998	toxin transport	IDA	biological process
GO:1901998	toxin transport	IDA	biological process
GO:0015695	organic cation transport	IDA	biological process
GO:0015695	organic cation transport	IDA	biological process
GO:0015871	choline transport	IDA	biological process
GO:0042910	xenobiotic transmembrane transporter activity	IMP	molecular function
GO:0019534	toxin transmembrane transporter activity	IMP	molecular function
GO:0051620	norepinephrine uptake	IDA	biological process
GO:0015234	thiamine transmembrane transporter activity	ISS	molecular function
GO:0015837	amine transport	IDA	biological process
GO:0051610	serotonin uptake	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	ISS	biological process
GO:0140125	thiamine import across plasma membrane	ISS	biological process
GO:0051615	histamine uptake	IDA	biological process
GO:0090494	dopamine uptake	IDA	biological process
GO:1990962	xenobiotic transport across blood-brain barrier	NAS	biological process
GO:0042908	xenobiotic transport	IMP	biological process
GO:1901998	toxin transport	IMP	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0015695	organic cation transport	IBA	biological process
GO:0015101	organic cation transmembrane transporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015101	organic cation transmembrane transporter activity	TAS	molecular function
GO:0015695	organic cation transport	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007589	body fluid secretion	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0015695	organic cation transport	IDA	biological process
GO:0015101	organic cation transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006855	drug transmembrane transport	TAS	biological process
GO:0007269	neurotransmitter secretion	TAS	biological process
GO:0042136	neurotransmitter biosynthetic process	TAS	biological process
GO:0006812	cation transport	IEA	biological process
GO:0015101	organic cation transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05231	Choline metabolism in cancer

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)