• Gene id: 6581

Gene Summary

• Gene Symbol: SLC22A3   Gene   UCSC   Ensembl
• Aliases: EMT, EMTH, OCT3
• Gene name: solute carrier family 22 member 3
• Alternate names: solute carrier family 22 member 3, EMT organic cation transporter 3, extraneuronal monoamine transporter, organic cation transporter 3, solute carrier family 22 (extraneuronal monoamine transporter), member 3, solute carrier family 22 (organic cation transport,
• Gene location: 6q25.3 (160348377: 160454981)     Exons: 15     NC_000006.12
• Gene summary(Entrez): Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c
• OMIM: 603745

Protein Summary

• Protein general information: O75751  
  • Name: Solute carrier family 22 member 3 (Extraneuronal monoamine transporter) (EMT) (Organic cation transporter 3)
  • Length: 556  
  • Mass: 61280
  • Tissue specificity: Expressed in placenta, skeletal muscle, prostate, aorta, liver, fetal lung, salivary gland, adrenal gland, kidney and brain cortex. No expression detected in spleen. {ECO
• Sequence:

  MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALAERCGWSPEEEWNRTA
  PASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVN
  AWMLDLTQAILNLGFLTGAFTLGYAADRYGRIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMT
  CYVIVTEIVGSKQRRIVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK
  GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFTSAVVYQGLVMRLGII
  GGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVACLVTAFLPEGIAWLRTTVATLGRLGITMAF
  EIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIAL
  PETVDDVEKLGSPHSCKCGRNKKTPVSRSHL

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  IPR004749  IPR005829  
  • Prosite: PS50850 PS00216
  • STRING: ENSP00000275300
• Other Databases: GeneCards:  SLC22A3  Malacards:  SLC22A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006836	neurotransmitter transport	IDA	biological process
GO:0005326	neurotransmitter transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0042908	xenobiotic transport	IDA	biological process
GO:0042908	xenobiotic transport	IDA	biological process
GO:0008504	monoamine transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0019534	toxin transmembrane transporter activity	IDA	molecular function
GO:0015101	organic cation transmembrane transporter activity	IDA	molecular function
GO:0042910	xenobiotic transmembrane transporter activity	IDA	molecular function
GO:0042910	xenobiotic transmembrane transporter activity	IDA	molecular function
GO:0005326	neurotransmitter transmembrane transporter activity	IMP	molecular function
GO:1901998	toxin transport	IDA	biological process
GO:0008504	monoamine transmembrane transporter activity	IMP	molecular function
GO:0015695	organic cation transport	IDA	biological process
GO:0051625	epinephrine uptake	IDA	biological process
GO:0008514	organic anion transmembrane transporter activity	ISS	molecular function
GO:0051620	norepinephrine uptake	IDA	biological process
GO:0051610	serotonin uptake	IDA	biological process
GO:0051615	histamine uptake	IDA	biological process
GO:0090494	dopamine uptake	IDA	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0015711	organic anion transport	ISS	biological process
GO:0015844	monoamine transport	IMP	biological process
GO:0001692	histamine metabolic process	TAS	biological process
GO:0051615	histamine uptake	IMP	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015101	organic cation transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0015695	organic cation transport	TAS	biological process
GO:0015697	quaternary ammonium group transport	IDA	biological process
GO:0015695	organic cation transport	IDA	biological process
GO:0015695	organic cation transport	IDA	biological process
GO:0015651	quaternary ammonium group transmembrane transporter activity	IDA	molecular function
GO:0015101	organic cation transmembrane transporter activity	IDA	molecular function
GO:0015101	organic cation transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015101	organic cation transmembrane transporter activity	TAS	molecular function
GO:0015101	organic cation transmembrane transporter activity	TAS	molecular function
GO:0006855	drug transmembrane transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032098	regulation of appetite	IEA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0015697	quaternary ammonium group transport	IEA	biological process
GO:0015695	organic cation transport	IEA	biological process
GO:0015651	quaternary ammonium group transmembrane transporter activity	IEA	molecular function
GO:0015872	dopamine transport	IEA	biological process
GO:0015697	quaternary ammonium group transport	IEA	biological process
GO:0015695	organic cation transport	IEA	biological process
GO:0015651	quaternary ammonium group transmembrane transporter activity	IEA	molecular function
GO:0005330	dopamine:sodium symporter activity	IEA	molecular function
GO:0051615	histamine uptake	IEA	biological process
GO:0051608	histamine transport	IEA	biological process
GO:0015844	monoamine transport	IEA	biological process
GO:0015101	organic cation transmembrane transporter activity	IEA	molecular function
GO:0019534	toxin transmembrane transporter activity	IEA	molecular function
GO:0015101	organic cation transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05231	Choline metabolism in cancer

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq