• Gene id: 6580

Gene Summary

• Gene Symbol: SLC22A1   Gene   UCSC   Ensembl
• Aliases: HOCT1, OCT1, oct1_cds
• Gene name: solute carrier family 22 member 1
• Alternate names: solute carrier family 22 member 1, organic cation transporter 1, solute carrier family 22 (organic cation transporter), member 1,
• Gene location: 6q25.3 (160121807: 160160589)     Exons: 13     NC_000006.12
• Gene summary(Entrez): Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c
• OMIM: 604842

Protein Summary

• Protein general information: O15245  
  • Name: Solute carrier family 22 member 1 (Organic cation transporter 1) (hOCT1)
  • Length: 554  
  • Mass: 61154
  • Tissue specificity: Widely expressed with high level in liver. Isoform 1 and isoform 2 are expressed in liver. Isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in glial cell lines. {ECO
• Sequence:

  MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQRCGWSPAEELNYTVP
  GLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLDL
  FQSCLNAGFLFGSLGVGYFADRFGRKLCLLGTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLIT
  EFVGSGSRRTVAIMYQMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
  IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVLYQGLILHMGATSGNL
  YLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVMIFISPDLHWLNIIIMCVGRMGITIAIQMIC
  LVNAELYPTFVRNLGVMVCSSLCDIGGIITPFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETM
  KDAENLGRKAKPKENTIYLKVQTSEPSGT

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  IPR004749  IPR005829  
  • Prosite: PS50850 PS00216
  • STRING: ENSP00000355930
• Other Databases: GeneCards:  SLC22A1  Malacards:  SLC22A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006836	neurotransmitter transport	IDA	biological process
GO:0005326	neurotransmitter transmembrane transporter activity	IDA	molecular function
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0042908	xenobiotic transport	IDA	biological process
GO:0008504	monoamine transmembrane transporter activity	IDA	molecular function
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0019534	toxin transmembrane transporter activity	IDA	molecular function
GO:0015101	organic cation transmembrane transporter activity	IDA	molecular function
GO:0042910	xenobiotic transmembrane transporter activity	IDA	molecular function
GO:0015651	quaternary ammonium group transmembrane transporter activity	IDA	molecular function
GO:1901998	toxin transport	IDA	biological process
GO:0042910	xenobiotic transmembrane transporter activity	IMP	molecular function
GO:0015695	organic cation transport	IDA	biological process
GO:0015697	quaternary ammonium group transport	IDA	biological process
GO:0015874	norepinephrine transport	IDA	biological process
GO:0042910	xenobiotic transmembrane transporter activity	IMP	molecular function
GO:0019534	toxin transmembrane transporter activity	IMP	molecular function
GO:0015234	thiamine transmembrane transporter activity	ISS	molecular function
GO:0051610	serotonin uptake	IDA	biological process
GO:0140125	thiamine import across plasma membrane	ISS	biological process
GO:0090494	dopamine uptake	IDA	biological process
GO:1990962	xenobiotic transport across blood-brain barrier	NAS	biological process
GO:0042908	xenobiotic transport	IMP	biological process
GO:0042908	xenobiotic transport	IMP	biological process
GO:1901998	toxin transport	IMP	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0015695	organic cation transport	IBA	biological process
GO:0015101	organic cation transmembrane transporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006855	drug transmembrane transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048241	epinephrine transport	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0015844	monoamine transport	IEA	biological process
GO:0015101	organic cation transmembrane transporter activity	IEA	molecular function
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	IEA	biological process
GO:0008513	secondary active organic cation transmembrane transporter activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005334	norepinephrine:sodium symporter activity	IEA	molecular function
GO:0015101	organic cation transmembrane transporter activity	IEA	molecular function
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0015874	norepinephrine transport	IEA	biological process
GO:0015872	dopamine transport	IEA	biological process
GO:0015697	quaternary ammonium group transport	IEA	biological process
GO:0015695	organic cation transport	IEA	biological process
GO:0015651	quaternary ammonium group transmembrane transporter activity	IEA	molecular function
GO:0008504	monoamine transmembrane transporter activity	IEA	molecular function
GO:0005330	dopamine:sodium symporter activity	IEA	molecular function
GO:0005277	acetylcholine transmembrane transporter activity	IEA	molecular function
GO:0006812	cation transport	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:1901374	acetate ester transport	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0051620	norepinephrine uptake	IEA	biological process
GO:0015101	organic cation transmembrane transporter activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0015695	organic cation transport	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05231	Choline metabolism in cancer
hsa04976	Bile secretion

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq