• Gene id: 6579

Gene Summary

• Gene Symbol: SLCO1A2   Gene   UCSC   Ensembl
• Aliases: OATP, OATP-A, OATP1A2, SLC21A3
• Gene name: solute carrier organic anion transporter family member 1A2
• Alternate names: solute carrier organic anion transporter family member 1A2, OATP-1, organic anion transporting polypeptide A, organic anion-transporting polypeptide 1, sodium-independent organic anion transporter, solute carrier family 21 (organic anion transporter), member 3,
• Gene location: 12p12.1 (21403662: 21264599)     Exons: 9     NC_000012.12
• Gene summary(Entrez): This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute c
• OMIM: 602883

Protein Summary

• Protein general information: P46721  
  • Name: Solute carrier organic anion transporter family member 1A2 (OATP A) (Organic anion transporting polypeptide 1) (OATP 1) (Sodium independent organic anion transporter) (Solute carrier family 21 member 3)
  • Length: 670  
  • Mass: 74145
• Sequence:

  MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNLLLIIF
  VSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVSVSGNLSSNSFLCMENGTQILRPTQDPSECT
  KEVKSLMWVYVLVGNIVRGMGETPILPLGISYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTG
  FVNTDDLIITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG
  ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGIYNLPPICIGYIIGGL
  IMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIW
  DPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYS
  LAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
  YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTVLKDDELKTKL

• Structural information:
  • Protein Domains: (433..48-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798"-)
  • Interpro: IPR002350  IPR036058  IPR020846  IPR036259  IPR004156  
  • Prosite: PS51465 PS50850
  • STRING: ENSP00000305974
• Other Databases: GeneCards:  SLCO1A2  Malacards:  SLCO1A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0043252	sodium-independent organic anion transport	IBA	biological process
GO:0015125	bile acid transmembrane transporter activity	IBA	molecular function
GO:0015347	sodium-independent organic anion transmembrane transporter activity	IBA	molecular function
GO:0015721	bile acid and bile salt transport	IBA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008514	organic anion transmembrane transporter activity	TAS	molecular function
GO:0015711	organic anion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0043252	sodium-independent organic anion transport	TAS	biological process
GO:0015125	bile acid transmembrane transporter activity	TAS	molecular function
GO:0015721	bile acid and bile salt transport	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04976	Bile secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)