• Gene id: 6575

Gene Summary

• Gene Symbol: SLC20A2   Gene   UCSC   Ensembl
• Aliases: GLVR-2, GLVR2, IBGC1, IBGC2, IBGC3, MLVAR, PIT-2, PIT2, RAM1, Ram-1
• Gene name: solute carrier family 20 member 2
• Alternate names: sodium-dependent phosphate transporter 2, epididymis secretory sperm binding protein, gibbon ape leukemia virus receptor 2, murine leukemia virus, amphotropic, receptor for, murine leukemia virus, amphotropic; receptor, solute carrier family 20 (phosphate tran,
• Gene location: 8p11.21 (42542142: 42416461)     Exons: 18     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the inorganic phosphate transporter family. The encoded protein is a type 3 sodium-dependent phosphate symporter that plays an important role in phosphate homeostasis by mediating cellular phosphate uptake. The encoded protei

Protein Summary

• Protein general information: Q08357  
  • Name: Sodium dependent phosphate transporter 2 (Gibbon ape leukemia virus receptor 2) (GLVR 2) (Phosphate transporter 2) (PiT 2) (Pit2) (hPit2) (Solute carrier family 20 member 2)
  • Length: 652  
  • Mass: 70392
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLGAKVGETIRKGII
  DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMELVKIVASWFIS
  PLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMYTGAPVLGLVLPMWAIALISFGVALL
  FAFFVWLFVCPWMRRKITGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEG
  TSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKDSGLYKDLLHKIHIDRGPEEKPAQES
  NYRLLRRNNSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVGDTVSYSKKRLRYDSYSSYCNAVAEAEIEAEEG
  GVEMKLASELADPDQPREDPAEEEKEEKDAPEVHLLFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGG
  VTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVG
  SVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALLMYGILPYV

• Structural information:
  • Interpro: IPR001204  
  • STRING: ENSP00000340465
• Other Databases: GeneCards:  SLC20A2  Malacards:  SLC20A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005315	inorganic phosphate transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0015319	sodium:inorganic phosphate symporter activity	IBA	molecular function
GO:0035435	phosphate ion transmembrane transport	IBA	biological process
GO:0006817	phosphate ion transport	IEA	biological process
GO:0005315	inorganic phosphate transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006817	phosphate ion transport	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005436	sodium:phosphate symporter activity	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Familial idiopathic basal ganglia calcification	KEGG:H01574
Familial idiopathic basal ganglia calcification	KEGG:H01574
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq