• Gene id: 6574

Gene Summary

• Gene Symbol: SLC20A1   Gene   UCSC   Ensembl
• Aliases: GLVR1, Glvr-1, PIT1, PiT-1
• Gene name: solute carrier family 20 member 1
• Alternate names: sodium-dependent phosphate transporter 1, gibbon ape leukemia virus receptor 1, leukemia virus receptor 1 homolog, solute carrier family 20 (phosphate transporter), member 1,
• Gene location: 2q14.1 (2992328: 2944436)     Exons: 21     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a sodium-phosphate symporter that absorbs phosphate from interstitial fluid for use in cellular functions such as metabolism, signal transduction, and nucleic acid and lipid synthesis. The encoded protein is also a retr
• OMIM: 137570

Protein Summary

• Protein general information: Q8WUM9  
  • Name: Sodium dependent phosphate transporter 1 (Gibbon ape leukemia virus receptor 1) (GLVR 1) (Leukemia virus receptor 1 homolog) (Phosphate transporter 1) (PiT 1) (Solute carrier family 20 member 1)
  • Length: 679  
  • Mass: 73700
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSV
  LLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGV
  KWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDK
  LPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSE
  VGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPNGNLVQFSQAVSNQINSSGH
  YQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTSYTMAICGMPLDSFRAKEGEQKGEEMEKLTW
  PNADSKKRIRMDSYTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVSLLFQFLQILTACF
  GSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGF
  SIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAIFRYV
  ILRM

• Structural information:
  • Interpro: IPR001204  
  • STRING: ENSP00000272542
• Other Databases: GeneCards:  SLC20A1  Malacards:  SLC20A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035435	phosphate ion transmembrane transport	IBA	biological process
GO:0015319	sodium:inorganic phosphate symporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005315	inorganic phosphate transmembrane transporter activity	IBA	molecular function
GO:0006817	phosphate ion transport	IEA	biological process
GO:0005315	inorganic phosphate transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006817	phosphate ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005436	sodium:phosphate symporter activity	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0006796	phosphate-containing compound metabolic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0031214	biomineral tissue development	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0006817	phosphate ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005316	high-affinity inorganic phosphate:sodium symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray