• Gene id: 6571

Gene Summary

• Gene Symbol: SLC18A2   Gene   UCSC   Ensembl
• Aliases: PKDYS2, SVAT, SVMT, VAT2, VMAT2
• Gene name: solute carrier family 18 member A2
• Alternate names: synaptic vesicular amine transporter, monoamine neurotransmitter transporter, solute carrier family 18 (vesicular monoamine transporter), member 2, synaptic vesicle amine transporter, brain, synaptic vesicle monoamine transporter, brain, vesicle monoamine tran,
• Gene location: 10q25.3 (117241113: 117279429)     Exons: 16     NC_000010.11
• Gene summary(Entrez): This gene encodes an transmembrane protein that functions as an ATP-dependent transporter of monoamines, such as dopamine, norepinephrine, serotonin, and histamine. This protein transports amine neurotransmitters into synaptic vesicles. Polymorphisms in t

Protein Summary

• Protein general information: Q05940  
  • Name: Synaptic vesicular amine transporter (Monoamine transporter) (Solute carrier family 18 member 2) (Vesicular amine transporter 2) (VAT2)
  • Length: 514  
  • Mass: 55713
• Sequence:

  MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSF
  QSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIG
  LLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIAL
  GGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS
  ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLCALLGMIIVGVSILCI
  PFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFP
  WLMTIIGIIDILFAPLCFFLRSPPAKEEKMAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000298472
• Other Databases: GeneCards:  SLC18A2  Malacards:  SLC18A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903427	negative regulation of reactive oxygen species biosynthetic process	NAS	biological process
GO:0008021	synaptic vesicle	TAS	cellular component
GO:0098700	neurotransmitter loading into synaptic vesicle	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0015872	dopamine transport	TAS	biological process
GO:0042137	sequestering of neurotransmitter	NAS	biological process
GO:0043195	terminal bouton	IBA	cellular component
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0008504	monoamine transmembrane transporter activity	IBA	molecular function
GO:0005335	serotonin:sodium symporter activity	IBA	molecular function
GO:0030672	synaptic vesicle membrane	IBA	cellular component
GO:0015842	aminergic neurotransmitter loading into synaptic vesicle	IBA	biological process
GO:0006836	neurotransmitter transport	IBA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006836	neurotransmitter transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008504	monoamine transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0015844	monoamine transport	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0070083	clathrin-sculpted monoamine transport vesicle membrane	TAS	cellular component
GO:0007269	neurotransmitter secretion	TAS	biological process
GO:0008504	monoamine transmembrane transporter activity	TAS	molecular function
GO:0008504	monoamine transmembrane transporter activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098700	neurotransmitter loading into synaptic vesicle	IEA	biological process
GO:0098691	dopaminergic synapse	IEA	cellular component
GO:0009791	post-embryonic development	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0051610	serotonin uptake	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05012	Parkinson disease
hsa05034	Alcoholism
hsa04728	Dopaminergic synapse
hsa04726	Serotonergic synapse
hsa04721	Synaptic vesicle cycle
hsa05031	Amphetamine addiction
hsa05030	Cocaine addiction
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Parkinson's disease	PMID:16421508
Parkinson's disease	PMID:16339215
type 1 diabetes mellitus	PMID:19223416
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq