• Gene id: 6568

Gene Summary

• Gene Symbol: SLC17A1   Gene   UCSC   Ensembl
• Aliases: NAPI-1, NPT-1, NPT1
• Gene name: solute carrier family 17 member 1
• Alternate names: sodium-dependent phosphate transport protein 1, Na(+)/PI cotransporter 1, na/Pi-4, renal Na(+)-dependent phosphate cotransporter 1, renal sodium-dependent phosphate transport protein 1, renal sodium-phosphate transport protein 1, sodium phosphate transporter, so,
• Gene location: 6p22.2 (25832107: 25723742)     Exons: 14     NC_000006.12
• OMIM: 182308

Protein Summary

• Protein general information: Q14916  
  • Name: Sodium dependent phosphate transport protein 1 (Na(+)/PI cotransporter 1) (Na/Pi 4) (Renal Na(+) dependent phosphate cotransporter 1) (Renal sodium dependent phosphate transport protein 1) (Renal sodium phosphate transport protein 1) (Sodium/phosphate cot
  • Length: 467  
  • Mass: 51132
  • Tissue specificity: Expressed in kidney cortex, liver and brain but not in other tissues.
• Sequence:

  MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNW
  SPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSVLSLLIPPAAGIGVAWVVVCRAVQGAAQGIV
  ATAQFEIYVKWAPPLERGRLTSMSTSGFLLGPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVLFYDDPK
  DHPCISISEKEYITSSLVQQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNIMTLYTPMFINSMLHVNIKEN
  GFLSSLPYLFAWICGNLAGQLSDFFLTRNILSVIAVRKLFTAAGFLLPAIFGVCLPYLSSTFYSIVIFLILAGAT
  GSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLILKQDPESAWFKTFILMAAINVTGLIFYLIV
  ATAEIQDWAKEKQHTRL

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  IPR004745  
  • Prosite: PS50850
  • STRING: ENSP00000244527
• Other Databases: GeneCards:  SLC17A1  Malacards:  SLC17A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IBA	molecular function
GO:0006820	anion transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0015747	urate transport	IMP	biological process
GO:0015114	phosphate ion transmembrane transporter activity	IEA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0035435	phosphate ion transmembrane transport	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005436	sodium:phosphate symporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0006817	phosphate ion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0046415	urate metabolic process	IMP	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0035725	sodium ion transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R