• Gene id: 6566

Gene Summary

• Gene Symbol: SLC16A1   Gene   UCSC   Ensembl
• Aliases: HHF7, MCT, MCT1, MCT1D
• Gene name: solute carrier family 16 member 1
• Alternate names: monocarboxylate transporter 1, MCT 1, solute carrier family 16 (monocarboxylate transporter), member 1, solute carrier family 16 (monocarboxylic acid transporters), member 1, solute carrier family 16, member 1 (monocarboxylic acid transporter 1),
• Gene location: 1p13.2 (112956195: 112911846)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a proton-linked monocarboxylate transporter that catalyzes the movement of many monocarboxylates, such as lactate and pyruvate, across the plasma membrane. Mutations in this gene are associated with erythrocyte lactate
• OMIM: 603820

Protein Summary

• Protein general information: P53985  
  • Name: Monocarboxylate transporter 1 (MCT 1) (Solute carrier family 16 member 1)
  • Length: 500  
  • Mass: 53944
  • Tissue specificity: Detected in heart and in blood lymphocytes and monocytes (at protein level). Widely expressed. {ECO
• Sequence:

  MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPI
  SSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLA
  MAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKD
  LHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAF
  LLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYAGFFGFAFGWLSSVLF
  ETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYKYTYWACGVVLIISGIYLFIGMGINYRLLAK
  EQKANEQKKESKEEETSIDVAGKPNEVTKAAESPDQKDTDGGPKEEESPV

• Structural information:
  • Interpro: IPR004743  IPR030757  IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000441065
• Other Databases: GeneCards:  SLC16A1  Malacards:  SLC16A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008028	monocarboxylic acid transmembrane transporter activity	IDA	molecular function
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0009925	basal plasma membrane	IDA	cellular component
GO:0008028	monocarboxylic acid transmembrane transporter activity	ISS	molecular function
GO:0016328	lateral plasma membrane	IDA	cellular component
GO:0046943	carboxylic acid transmembrane transporter activity	ISS	molecular function
GO:0015718	monocarboxylic acid transport	IDA	biological process
GO:0015129	lactate transmembrane transporter activity	TAS	molecular function
GO:0015129	lactate transmembrane transporter activity	ISS	molecular function
GO:1905039	carboxylic acid transmembrane transport	ISS	biological process
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0035879	plasma membrane lactate transport	TAS	biological process
GO:0035879	plasma membrane lactate transport	ISS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0015718	monocarboxylic acid transport	ISS	biological process
GO:0008028	monocarboxylic acid transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0015718	monocarboxylic acid transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0007098	centrosome cycle	IMP	biological process
GO:0035879	plasma membrane lactate transport	ISS	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0008028	monocarboxylic acid transmembrane transporter activity	IEA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0015129	lactate transmembrane transporter activity	IEA	molecular function
GO:0015718	monocarboxylic acid transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015130	mevalonate transmembrane transporter activity	TAS	molecular function
GO:0008028	monocarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0015718	monocarboxylic acid transport	TAS	biological process
GO:0015728	mevalonate transport	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006090	pyruvate metabolic process	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0032094	response to food	IEA	biological process
GO:0035873	lactate transmembrane transport	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0051780	behavioral response to nutrient	IEA	biological process
GO:0050796	regulation of insulin secretion	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0097159	organic cyclic compound binding	IEA	molecular function
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0035879	plasma membrane lactate transport	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Familial hyperinsulinemic hypoglycemia	KEGG:H01267
Familial hyperinsulinemic hypoglycemia	KEGG:H01267
Erythrocyte lactate transporter defect	KEGG:H01248
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray