• Gene id: 6565

Gene Summary

• Gene Symbol: SLC15A2   Gene   UCSC   Ensembl
• Aliases: PEPT2
• Gene name: solute carrier family 15 member 2
• Alternate names: solute carrier family 15 member 2, kidney H(+)/peptide cotransporter, oligopeptide transporter, kidney isoform, peptide transporter 2, solute carrier family 15 (H+/peptide transporter), member 2, solute carrier family 15 (oligopeptide transporter), member 2,
• Gene location: 3q13.33 (121894400: 121944187)     Exons: 23     NC_000003.12
• Gene summary(Entrez): The mammalian kidney expresses a proton-coupled peptide transporter that is responsible for the absorption of small peptides, as well as beta-lactam antibiotics and other peptide-like drugs, from the tubular filtrate. This transporter, SLC15A2, belongs to
• OMIM: 602339

Protein Summary

• Protein general information: Q16348  
  • Name: Solute carrier family 15 member 2 (Kidney H(+)/peptide cotransporter) (Oligopeptide transporter, kidney isoform) (Peptide transporter 2)
  • Length: 729  
  • Mass: 81783
  • Tissue specificity: Expressed in kidney. Not detected in intestine. {ECO
• Sequence:

  MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSYYGMKAVLILYFLYFL
  HWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVIKSLGALPILGGQVVHTVLSLIGL
  SLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPG
  LLMVIALVVFAMGSKIYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALT
  RVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPLLVLIFIPLFDFVIYRLVSKCGINFS
  SLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLNLADDEVKVTVVGNENNSLLIESIKSFQKTP
  HYSKLHLKTKSQDFHFHLKYHNLSLYTEHSVQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHK
  DVNISLSTDTSLNVGEDYGVSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIED
  IPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIVLVVAQFSGLVQWAEF
  ILFSCLLLVICLIFSIMGYYYVPVKTEDMRGPADKHIPHIQGNMIKLETKKTKL

• Structural information:
  • Interpro: IPR029028  IPR036259  IPR004768  IPR000109  IPR018456  
  • Prosite: PS01022 PS01023
  • PDB: 6EZI
  • PDBsum: 6EZI
  • STRING: ENSP00000417085
• Other Databases: GeneCards:  SLC15A2  Malacards:  SLC15A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0140206	dipeptide import across plasma membrane	IDA	biological process
GO:0140206	dipeptide import across plasma membrane	IDA	biological process
GO:0140206	dipeptide import across plasma membrane	IDA	biological process
GO:0071916	dipeptide transmembrane transporter activity	IDA	molecular function
GO:0071916	dipeptide transmembrane transporter activity	IDA	molecular function
GO:0071916	dipeptide transmembrane transporter activity	IDA	molecular function
GO:0015333	peptide:proton symporter activity	IDA	molecular function
GO:0015333	peptide:proton symporter activity	IDA	molecular function
GO:0005886	plasma membrane	IC	cellular component
GO:0005886	plasma membrane	IC	cellular component
GO:0044214	spanning component of plasma membrane	IC	cellular component
GO:0042938	dipeptide transport	ISS	biological process
GO:0042938	dipeptide transport	ISS	biological process
GO:0042938	dipeptide transport	ISS	biological process
GO:0070293	renal absorption	ISS	biological process
GO:0042908	xenobiotic transport	ISS	biological process
GO:0042908	xenobiotic transport	ISS	biological process
GO:0089717	spanning component of membrane	RCA	cellular component
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0035673	oligopeptide transmembrane transporter activity	IBA	molecular function
GO:0015333	peptide:proton symporter activity	IBA	molecular function
GO:0071916	dipeptide transmembrane transporter activity	IBA	molecular function
GO:1904680	peptide transmembrane transporter activity	IBA	molecular function
GO:0006857	oligopeptide transport	IEA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0035673	oligopeptide transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0015833	peptide transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015333	peptide:proton symporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1990961	xenobiotic detoxification by transmembrane export across the plasma membrane	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)