• Gene id: 6564

Gene Summary

• Gene Symbol: SLC15A1   Gene   UCSC   Ensembl
• Aliases: HPECT1, HPEPT1, PEPT1
• Gene name: solute carrier family 15 member 1
• Alternate names: solute carrier family 15 member 1, Caco-2 oligopeptide transporter, intestinal H+/peptide cotransporter, macrophage oligopeptide transporter PEPT1, oligopeptide transporter, small intestine isoform, peptide transporter 1, solute carrier family 15 (oligopeptide ,
• Gene location: 13q32.2-q32.3 (98752671: 98683800)     Exons: 23     NC_000013.11
• Gene summary(Entrez): This gene encodes an intestinal hydrogen peptide cotransporter that is a member of the solute carrier family 15. The encoded protein is localized to the brush border membrane of the intestinal epithelium and mediates the uptake of di- and tripeptides from
• OMIM: 602516

Protein Summary

• Protein general information: P46059  
  • Name: Solute carrier family 15 member 1 (Intestinal H(+)/peptide cotransporter) (Oligopeptide transporter, small intestine isoform) (Peptide transporter 1)
  • Length: 708  
  • Mass: 78806
• Sequence:

  MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFVALCYLTPILGALIAD
  SWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPVHVVLSLIGLALIALGTGGIKPCVSAFGGDQ
  FEEGQEKQRNRFFSIFYLAINAGSLLSTIITPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKK
  FKPQGNIMGKVAKCIGFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
  GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKKMAVGMVLASMAFVVA
  AIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNKLTRINISSPGSPVTAV
  TDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGI
  KGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
  TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVCVIFAIMARFYTYINP
  AEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM

• Structural information:
  • Interpro: IPR036259  IPR004768  IPR000109  IPR018456  
  • Prosite: PS01022 PS01023
  • STRING: ENSP00000365686
• Other Databases: GeneCards:  SLC15A1  Malacards:  SLC15A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0140206	dipeptide import across plasma membrane	IDA	biological process
GO:0071916	dipeptide transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IC	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0015333	peptide:proton symporter activity	IDA	molecular function
GO:0071916	dipeptide transmembrane transporter activity	ISS	molecular function
GO:0042937	tripeptide transmembrane transporter activity	ISS	molecular function
GO:0140206	dipeptide import across plasma membrane	ISS	biological process
GO:0140207	tripeptide import across plasma membrane	ISS	biological process
GO:0089717	spanning component of membrane	ISS	cellular component
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0015333	peptide:proton symporter activity	IBA	molecular function
GO:0071916	dipeptide transmembrane transporter activity	IBA	molecular function
GO:1904680	peptide transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0035673	oligopeptide transmembrane transporter activity	IBA	molecular function
GO:0006857	oligopeptide transport	IEA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0035673	oligopeptide transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0015833	peptide transport	IEA	biological process
GO:0015293	symporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0006857	oligopeptide transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0005427	proton-dependent oligopeptide secondary active transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015333	peptide:proton symporter activity	IDA	molecular function
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R