• Gene id: 6561

Gene Summary

• Gene Symbol: SLC13A1   Gene   UCSC   Ensembl
• Aliases: NAS1, NaSi-1
• Gene name: solute carrier family 13 member 1
• Alternate names: solute carrier family 13 member 1, Na(+)/sulfate cotransporter, renal sodium/sulfate cotransporter, solute carrier family 13 (sodium/sulfate symporters), member 1, solute carrier family 13 (sodium/sulphate symporters), member 1,
• Gene location: 7q31.32 (123201835: 123113489)     Exons: 1     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is an apical membrane Na(+)-sulfate cotransporter involved in sulfate homeostasis in the kidney. Defects in this gene lead to many pathophysiologic problems. [provided by RefSeq, May 2016]
• OMIM: 606193

Protein Summary

• Protein general information: Q9BZW2  
  • Name: Solute carrier family 13 member 1 (Renal sodium/sulfate cotransporter) (Na(+)/sulfate cotransporter) (hNaSi 1)
  • Length: 595  
  • Mass: 66134
  • Tissue specificity: Highly expressed in kidney; not detectable in the other tissues tested.
• Sequence:

  MKFFSYILVYRRFLFVVFTVLVLLPLPIVLHTKEAECAYTLFVVATFWLTEALPLSVTALLPSLMLPMFGIMPSK
  KVASAYFKDFHLLLIGVICLATSIEKWNLHKRIALKMVMMVGVNPAWLTLGFMSSTAFLSMWLSNTSTAAMVMPI
  AEAVVQQIINAEAEVEATQMTYFNGSTNHGLEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELEKNSGMR
  TKYRTKKGHVTRKLTCLCIAYSSTIGGLTTITGTSTNLIFAEYFNTRYPDCRCLNFGSWFTFSFPAALIILLLSW
  IWLQWLFLGFNFKEMFKCGKTKTVQQKACAEVIKQEYQKLGPIRYQEIVTLVLFIIMALLWFSRDPGFVPGWSAL
  FSEYPGFATDSTVALLIGLLFFLIPAKTLTKTTPTGEIVAFDYSPLITWKEFQSFMPWDIAILVGGGFALADGCE
  ESGLSKWIGNKLSPLGSLPAWLIILISSLMVTSLTEVASNPATITLFLPILSPLAEAIHVNPLYILIPSTLCTSF
  AFLLPVANPPNAIVFSYGHLKVIDMVKAGLGVNIVGVAVVMLGICTWIVPMFDLYTYPSWAPAMSNETMP

• Structural information:
  • Interpro: IPR031312  IPR001898  
  • Prosite: PS01271
  • STRING: ENSP00000194130
• Other Databases: GeneCards:  SLC13A1  Malacards:  SLC13A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015746	citrate transport	IBA	biological process
GO:0015141	succinate transmembrane transporter activity	IBA	molecular function
GO:0098656	anion transmembrane transport	IBA	biological process
GO:0017153	sodium:dicarboxylate symporter activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0015382	sodium:sulfate symporter activity	IBA	molecular function
GO:0015137	citrate transmembrane transporter activity	IBA	molecular function
GO:0008272	sulfate transport	IBA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0008272	sulfate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0015382	sodium:sulfate symporter activity	TAS	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0008271	secondary active sulfate transmembrane transporter activity	IEA	molecular function
GO:0008272	sulfate transport	IEA	biological process
GO:0008272	sulfate transport	IEA	biological process
GO:0015382	sodium:sulfate symporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:0071422	succinate transmembrane transport	IEA	biological process
GO:0006835	dicarboxylic acid transport	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R