• Gene id: 6556

Gene Summary

• Gene Symbol: SLC11A1   Gene   UCSC   Ensembl
• Aliases: LSH, NRAMP, NRAMP1
• Gene name: solute carrier family 11 member 1
• Alternate names: natural resistance-associated macrophage protein 1, NRAMP 1, solute carrier family 11 (proton-coupled divalent metal ion transporter), member 1, solute carrier family 11 (proton-coupled divalent metal ion transporters), member 1, solute carrier family 11 (sod,
• Gene location: 2q35 (218381765: 218396893)     Exons: 16     NC_000002.12
• Gene summary(Entrez): This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron

Protein Summary

• Protein general information: P49279  
  • Name: Natural resistance associated macrophage protein 1 (NRAMP 1) (Solute carrier family 11 member 1)
  • Length: 550  
  • Mass: 59872
  • Tissue specificity: Macrophages; peripheral blood leukocytes, lung, spleen and liver.
• Sequence:

  MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLSEKIPIPDTKPGTFSLRKLWAFTGPGFLMSIAFLDP
  GNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLTIELAIVGSDM
  QEVIGTAIAFNLLSAGRIPLWGGVLITIVDTFFFLFLDNYGLRKLEAFFGLLITIMALTFGYEYVVARPEQGALL
  RGLFLPSCPGCGHPELLQAVGIVGAIIMPHNIYLHSALVKSREIDRARRADIREANMYFLIEATIALSVSFIINL
  FVMAVFGQAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDIYQGGVILGCLFGPAALYIWAIGLLAAGQSS
  TMTGTYAGQFVMEGFLRLRWSRFARVLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT
  SMPTLMQEFANGLLNKVVTSSIMVLVCAINLYFVVSYLPSLPHPAYFGLAALLAAAYLGLSTYLVWTCCLAHGAT
  FLAHSSHHHFLYGLLEEDQKGETSG

• Structural information:
  • Interpro: IPR001046  
  • STRING: ENSP00000233202
• Other Databases: GeneCards:  SLC11A1  Malacards:  SLC11A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005381	iron ion transmembrane transporter activity	IBA	molecular function
GO:0005384	manganese ion transmembrane transporter activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0030670	phagocytic vesicle membrane	IBA	cellular component
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0006876	cellular cadmium ion homeostasis	IBA	biological process
GO:0006879	cellular iron ion homeostasis	IBA	biological process
GO:0009617	response to bacterium	IBA	biological process
GO:0015086	cadmium ion transmembrane transporter activity	IBA	molecular function
GO:0051139	metal ion:proton antiporter activity	IBA	molecular function
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0045454	cell redox homeostasis	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0031902	late endosome membrane	TAS	cellular component
GO:0051139	metal ion:proton antiporter activity	TAS	molecular function
GO:1902023	L-arginine transport	IEA	biological process
GO:0070839	divalent metal ion export	IEA	biological process
GO:0060586	multicellular organismal iron ion homeostasis	IEA	biological process
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0050766	positive regulation of phagocytosis	IEA	biological process
GO:0048255	mRNA stabilization	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042116	macrophage activation	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0032632	interleukin-3 production	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0015707	nitrite transport	IEA	biological process
GO:0010008	endosome membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006828	manganese ion transport	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0005384	manganese ion transmembrane transporter activity	IEA	molecular function
GO:0048002	antigen processing and presentation of peptide antigen	IEA	biological process
GO:0045730	respiratory burst	IEA	biological process
GO:0045342	MHC class II biosynthetic process	IEA	biological process
GO:0042832	defense response to protozoan	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0034341	response to interferon-gamma	IEA	biological process
GO:0032623	interleukin-2 production	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0007035	vacuolar acidification	IEA	biological process
GO:0006909	phagocytosis	IEA	biological process
GO:0006879	cellular iron ion homeostasis	IEA	biological process
GO:0006826	iron ion transport	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0002827	positive regulation of T-helper 1 type immune response	IEA	biological process
GO:0002606	positive regulation of dendritic cell antigen processing and presentation	IEA	biological process
GO:0002369	T cell cytokine production	IEA	biological process
GO:0002309	T cell proliferation involved in immune response	IEA	biological process
GO:0001819	positive regulation of cytokine production	IEA	biological process
GO:0001818	negative regulation of cytokine production	IEA	biological process
GO:0051139	metal ion:proton antiporter activity	IGI	molecular function
GO:0005384	manganese ion transmembrane transporter activity	ISS	molecular function
GO:0046915	transition metal ion transmembrane transporter activity	IGI	molecular function
GO:0001818	negative regulation of cytokine production	ISS	biological process
GO:0001819	positive regulation of cytokine production	ISS	biological process
GO:0002309	T cell proliferation involved in immune response	ISS	biological process
GO:0002369	T cell cytokine production	ISS	biological process
GO:0002606	positive regulation of dendritic cell antigen processing and presentation	ISS	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	ISS	biological process
GO:0005764	lysosome	ISS	cellular component
GO:0006826	iron ion transport	IMP	biological process
GO:0006876	cellular cadmium ion homeostasis	IGI	biological process
GO:0006879	cellular iron ion homeostasis	IMP	biological process
GO:0006909	phagocytosis	ISS	biological process
GO:0007035	vacuolar acidification	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0032623	interleukin-2 production	ISS	biological process
GO:0034341	response to interferon-gamma	ISS	biological process
GO:0042060	wound healing	ISS	biological process
GO:0042832	defense response to protozoan	ISS	biological process
GO:0045342	MHC class II biosynthetic process	ISS	biological process
GO:0045730	respiratory burst	ISS	biological process
GO:0048002	antigen processing and presentation of peptide antigen	ISS	biological process
GO:0030670	phagocytic vesicle membrane	IDA	cellular component
GO:0070821	tertiary granule membrane	IDA	cellular component
GO:0005770	late endosome	ISS	cellular component
GO:0005886	plasma membrane	IMP	cellular component
GO:0006828	manganese ion transport	ISS	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0015707	nitrite transport	ISS	biological process
GO:0032147	activation of protein kinase activity	ISS	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0032632	interleukin-3 production	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0042116	macrophage activation	ISS	biological process
GO:0042742	defense response to bacterium	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0048255	mRNA stabilization	ISS	biological process
GO:0050766	positive regulation of phagocytosis	ISS	biological process
GO:0050829	defense response to Gram-negative bacterium	ISS	biological process
GO:0055072	iron ion homeostasis	ISS	biological process
GO:0060586	multicellular organismal iron ion homeostasis	ISS	biological process
GO:0070574	cadmium ion transmembrane transport	IGI	biological process
GO:0070839	divalent metal ion export	ISS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0034755	iron ion transmembrane transport	IEA	biological process
GO:0071421	manganese ion transmembrane transport	IEA	biological process
GO:0071421	manganese ion transmembrane transport	IEA	biological process
GO:0071421	manganese ion transmembrane transport	IEA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0009617	response to bacterium	IDA	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005381	iron ion transmembrane transporter activity	IBA	molecular function
GO:0005384	manganese ion transmembrane transporter activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0030670	phagocytic vesicle membrane	IBA	cellular component
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0006876	cellular cadmium ion homeostasis	IBA	biological process
GO:0006879	cellular iron ion homeostasis	IBA	biological process
GO:0009617	response to bacterium	IBA	biological process
GO:0015086	cadmium ion transmembrane transporter activity	IBA	molecular function
GO:0051139	metal ion:proton antiporter activity	IBA	molecular function
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0045454	cell redox homeostasis	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0031902	late endosome membrane	TAS	cellular component
GO:0051139	metal ion:proton antiporter activity	TAS	molecular function
GO:1902023	L-arginine transport	IEA	biological process
GO:0070839	divalent metal ion export	IEA	biological process
GO:0060586	multicellular organismal iron ion homeostasis	IEA	biological process
GO:0055072	iron ion homeostasis	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0050766	positive regulation of phagocytosis	IEA	biological process
GO:0048255	mRNA stabilization	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042116	macrophage activation	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0032632	interleukin-3 production	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0015707	nitrite transport	IEA	biological process
GO:0010008	endosome membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006828	manganese ion transport	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0005384	manganese ion transmembrane transporter activity	IEA	molecular function
GO:0048002	antigen processing and presentation of peptide antigen	IEA	biological process
GO:0045730	respiratory burst	IEA	biological process
GO:0045342	MHC class II biosynthetic process	IEA	biological process
GO:0042832	defense response to protozoan	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0034341	response to interferon-gamma	IEA	biological process
GO:0032623	interleukin-2 production	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0007035	vacuolar acidification	IEA	biological process
GO:0006909	phagocytosis	IEA	biological process
GO:0006879	cellular iron ion homeostasis	IEA	biological process
GO:0006826	iron ion transport	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0002827	positive regulation of T-helper 1 type immune response	IEA	biological process
GO:0002606	positive regulation of dendritic cell antigen processing and presentation	IEA	biological process
GO:0002369	T cell cytokine production	IEA	biological process
GO:0002309	T cell proliferation involved in immune response	IEA	biological process
GO:0001819	positive regulation of cytokine production	IEA	biological process
GO:0001818	negative regulation of cytokine production	IEA	biological process
GO:0051139	metal ion:proton antiporter activity	IGI	molecular function
GO:0005384	manganese ion transmembrane transporter activity	ISS	molecular function
GO:0046915	transition metal ion transmembrane transporter activity	IGI	molecular function
GO:0001818	negative regulation of cytokine production	ISS	biological process
GO:0001819	positive regulation of cytokine production	ISS	biological process
GO:0002309	T cell proliferation involved in immune response	ISS	biological process
GO:0002369	T cell cytokine production	ISS	biological process
GO:0002606	positive regulation of dendritic cell antigen processing and presentation	ISS	biological process
GO:0002827	positive regulation of T-helper 1 type immune response	ISS	biological process
GO:0005764	lysosome	ISS	cellular component
GO:0006826	iron ion transport	IMP	biological process
GO:0006876	cellular cadmium ion homeostasis	IGI	biological process
GO:0006879	cellular iron ion homeostasis	IMP	biological process
GO:0006909	phagocytosis	ISS	biological process
GO:0007035	vacuolar acidification	ISS	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0032623	interleukin-2 production	ISS	biological process
GO:0034341	response to interferon-gamma	ISS	biological process
GO:0042060	wound healing	ISS	biological process
GO:0042832	defense response to protozoan	ISS	biological process
GO:0045342	MHC class II biosynthetic process	ISS	biological process
GO:0045730	respiratory burst	ISS	biological process
GO:0048002	antigen processing and presentation of peptide antigen	ISS	biological process
GO:0030670	phagocytic vesicle membrane	IDA	cellular component
GO:0070821	tertiary granule membrane	IDA	cellular component
GO:0005770	late endosome	ISS	cellular component
GO:0005886	plasma membrane	IMP	cellular component
GO:0006828	manganese ion transport	ISS	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0015707	nitrite transport	ISS	biological process
GO:0032147	activation of protein kinase activity	ISS	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0032632	interleukin-3 production	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0042116	macrophage activation	ISS	biological process
GO:0042742	defense response to bacterium	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0048255	mRNA stabilization	ISS	biological process
GO:0050766	positive regulation of phagocytosis	ISS	biological process
GO:0050829	defense response to Gram-negative bacterium	ISS	biological process
GO:0055072	iron ion homeostasis	ISS	biological process
GO:0060586	multicellular organismal iron ion homeostasis	ISS	biological process
GO:0070574	cadmium ion transmembrane transport	IGI	biological process
GO:0070839	divalent metal ion export	ISS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0034755	iron ion transmembrane transport	IEA	biological process
GO:0071421	manganese ion transmembrane transport	IEA	biological process
GO:0071421	manganese ion transmembrane transport	IEA	biological process
GO:0071421	manganese ion transmembrane transport	IEA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0009617	response to bacterium	IDA	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04142	Lysosome

Diseases

Associated diseases	References
Inflammatory bowel disease	PMID:21128323
Inflammatory bowel disease	PMID:16059695
Lymphoproliferative syndrome	PMID:16734634
urinary bladder cancer	PMID:16516037
Sarcoidosis	PMID:22160516
Behcet's disease	PMID:18998137
Multiple sclerosis	PMID:18973068
systemic scleroderma	PMID:17876529
juvenile rheumatoid arthritis	PMID:10857800
Rheumatoid arthritis	PMID:10719815
Crohn's disease	PMID:18340647
Systemic lupus erythematosus	PMID:21233146
type 1 diabetes mellitus	PMID:19768110
type 1 diabetes mellitus	PMID:15877293
type 1 diabetes mellitus	PMID:21524304
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881