• Gene id: 6555

Gene Summary

• Gene Symbol: SLC10A2   Gene   UCSC   Ensembl
• Aliases: ASBT, IBAT, ISBT, NTCP2, PBAM
• Gene name: solute carrier family 10 member 2
• Alternate names: ileal sodium/bile acid cotransporter, Na(+)-dependent ileal bile acid transporter, ileal apical sodium-dependent bile acid transporter, ileal sodium-dependent bile acid transporter, sodium/taurocholate cotransporting polypeptide, ileal, solute carrier family 1,
• Gene location: 13q33.1 (103066416: 103043997)     Exons: 6     NC_000013.11
• Gene summary(Entrez): This gene encodes a sodium/bile acid cotransporter. This transporter is the primary mechanism for uptake of intestinal bile acids by apical cells in the distal ileum. Bile acids are the catabolic product of cholesterol metabolism, so this protein is also
• OMIM: 609605

Protein Summary

• Protein general information: Q12908  
  • Name: Ileal sodium/bile acid cotransporter (Apical sodium dependent bile acid transporter) (ASBT) (Ileal Na(+)/bile acid cotransporter) (Ileal sodium dependent bile acid transporter) (IBAT) (ISBT) (Na(+) dependent ileal bile acid transporter) (Sodium/taurochola
  • Length: 348  
  • Mass: 37714
• Sequence:

  MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLGHIKRPWGICVGFLCQ
  FGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGMMPLCLLIYTK
  MWVDSGSIVIPYDNIGTSLVSLVVPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPK
  LWIIGTIFPVAGYSLGFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
  AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK

• Structural information:
  • Interpro: IPR002657  IPR004710  IPR038770  IPR030207  
  • STRING: ENSP00000245312
• Other Databases: GeneCards:  SLC10A2  Malacards:  SLC10A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016324	apical plasma membrane	IBA	cellular component
GO:0008508	bile acid:sodium symporter activity	IBA	molecular function
GO:0015721	bile acid and bile salt transport	IBA	biological process
GO:0008508	bile acid:sodium symporter activity	IEA	molecular function
GO:0015721	bile acid and bile salt transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0006814	sodium ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0008508	bile acid:sodium symporter activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008508	bile acid:sodium symporter activity	TAS	molecular function
GO:0015721	bile acid and bile salt transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009617	response to bacterium	IEA	biological process
GO:0005902	microvillus	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04976	Bile secretion

Diseases

Associated diseases	References
Primary bile acid malabsorption	KEGG:H01016
Primary bile acid malabsorption	KEGG:H01016
Intestinal disease	PMID:9109432
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R