• Gene id: 6549

Gene Summary

• Gene Symbol: SLC9A2   Gene   UCSC   Ensembl
• Aliases: NHE2
• Gene name: solute carrier family 9 member A2
• Alternate names: sodium/hydrogen exchanger 2, Na(+)/H(+) exchanger 2, solute carrier family 9 (sodium/hydrogen exchanger), member 2, solute carrier family 9, subfamily A (NHE2, cation proton antiporter 2), member 2,
• Gene location: 2q12.1 (102619552: 102711354)     Exons: 12     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the sodium-hydrogen exchanger (NHE) protein family. These proteins are involved in sodium-ion transport by exchanging intracellular hydrogen ions to external sodium ions and help in the regulation of cell pH and volume. The e
• OMIM: 600530

Protein Summary

• Protein general information: Q9UBY0  
  • Name: Sodium/hydrogen exchanger 2 (Na(+)/H(+) exchanger 2) (NHE 2) (Solute carrier family 9 member 2)
  • Length: 812  
  • Mass: 91520
  • Tissue specificity: Expressed in skeletal muscle, colon and kidney. Lower levels in the testis, prostate, ovary, and small intestine.
• Sequence:

  MEPLGNWRSLRAPLPPMLLLLLLQVAGPVGALAETLLNAPRAMGTSSSPPSPASVVAPGTTLFEESRLPVFTLDY
  PHVQIPFEITLWILLASLAKIGFHLYHKLPTIVPESCLLIMVGLLLGGIIFGVDEKSPPAMKTDVFFLYLLPPIV
  LDAGYFMPTRPFFENIGTIFWYAVVGTLWNSIGIGVSLFGICQIEAFGLSDITLLQNLLFGSLISAVDPVAVLAV
  FENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIETIDVFAGIANFFVVGIGGVLIGIFLGFIAAFTT
  RFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIKYFMKMLSSVSETLIF
  IFMGVSTVGKNHEWNWAFVCFTLAFCLMWRALGVFVLTQVINRFRTIPLTFKDQFIIAYGGLRGAICFALVFLLP
  AAVFPRKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKRSNKKQQAVSEEIYCRLFDHVKTGIEDVCGHWGHNF
  WRDKFKKFDDKYLRKLLIRENQPKSSIVSLYKKLEIKHAIEMAETGMISTVPTFASLNDCREEKIRKVTSSETDE
  IRELLSRNLYQIRQRTLSYNRHSLTADTSERQAKEILIRRRHSLRESIRKDSSLNREHRASTSTSRYLSLPKNTK
  LPEKLQKRRTISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKSPQSYKMEWKNEVDVDSGRDMPSTPPTP
  HSREKGTQTSGLLQQPLLSKDQSGSEREDSLTEGIPPKPPPRLVWRASEPGSRKARFGSEKP

• Structural information:
  • Interpro: IPR006153  IPR018422  IPR001953  IPR004709  IPR032103  
  • STRING: ENSP00000233969
• Other Databases: GeneCards:  SLC9A2  Malacards:  SLC9A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098719	sodium ion import across plasma membrane	IBA	biological process
GO:0015385	sodium:proton antiporter activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0051453	regulation of intracellular pH	IBA	biological process
GO:0015386	potassium:proton antiporter activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0006812	cation transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0015299	solute:proton antiporter activity	IEA	molecular function
GO:0015385	sodium:proton antiporter activity	IEA	molecular function
GO:0006885	regulation of pH	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015385	sodium:proton antiporter activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0008104	protein localization	IEA	biological process
GO:0006885	regulation of pH	IEA	biological process
GO:0015385	sodium:proton antiporter activity	IEA	molecular function
GO:0006814	sodium ion transport	IEA	biological process
GO:0015385	sodium:proton antiporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0098656	anion transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881