• Gene id: 6541

Gene Summary

• Gene Symbol: SLC7A1   Gene   UCSC   Ensembl
• Aliases: ATRC1, CAT-1, ERR, HCAT1, REC1L
• Gene name: solute carrier family 7 member 1
• Alternate names: high affinity cationic amino acid transporter 1, CAT1, amino acid transporter, cationic 1, ecotropic retroviral leukemia receptor homolog, ecotropic retroviral receptor, ecotropic retrovirus receptor homolog, solute carrier family 7 (cationic amino acid transpo,
• Gene location: 13q12.3 (29595687: 29509409)     Exons: 14     NC_000013.11
• OMIM: 104615

Protein Summary

• Protein general information: P30825  
  • Name: High affinity cationic amino acid transporter 1 (CAT 1) (CAT1) (Ecotropic retroviral leukemia receptor homolog) (Ecotropic retrovirus receptor homolog) (Solute carrier family 7 member 1) (System Y+ basic amino acid transporter)
  • Length: 629  
  • Mass: 67638
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MGCKVLLNIGQQMLRRKVVDCSREETRLSRCLNTFDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAAL
  ASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGRPIGEFSRT
  HMTLNAPGVLAENPDIFAVIIILILTGLLTLGVKESAMVNKIFTCINVLVLGFIMVSGFVKGSVKNWQLTEEDFG
  NTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIA
  YFGVSAALTLMMPYFCLDNNSPLPDAFKHVGWEGAKYAVAVGSLCALSASLLGSMFPMPRVIYAMAEDGLLFKFL
  ANVNDRTKTPIIATLASGAVAAVMAFLFDLKDLVDLMSIGTLLAYSLVAACVLVLRYQPEQPNLVYQMASTSDEL
  DPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIVNISTSLIAVLIITFCIVTVLGREALTKGA
  LWAVFLLAGSALLCAVVTGVIWRQPESKTKLSFKVPFLPVLPILSIFVNVYLMMQLDQGTWVRFAVWMLIGFIIY
  FGYGLWHSEEASLDADQARTPDGNLDQCK

• Structural information:
  • Interpro: IPR002293  IPR004755  IPR029485  
  • STRING: ENSP00000370128
• Other Databases: GeneCards:  SLC7A1  Malacards:  SLC7A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005290	L-histidine transmembrane transporter activity	IDA	molecular function
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:1903810	L-histidine import across plasma membrane	IDA	biological process
GO:0015174	basic amino acid transmembrane transporter activity	IDA	molecular function
GO:0015171	amino acid transmembrane transporter activity	IDA	molecular function
GO:0061459	L-arginine transmembrane transporter activity	ISS	molecular function
GO:0015181	arginine transmembrane transporter activity	IMP	molecular function
GO:0015819	lysine transport	IDA	biological process
GO:1990822	basic amino acid transmembrane transport	IMP	biological process
GO:0089718	amino acid import across plasma membrane	IDA	biological process
GO:0097638	L-arginine import across plasma membrane	ISS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0015822	ornithine transport	IMP	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0009925	basal plasma membrane	ISS	cellular component
GO:0009925	basal plasma membrane	ISS	cellular component
GO:1903826	arginine transmembrane transport	IMP	biological process
GO:0042102	positive regulation of T cell proliferation	IMP	biological process
GO:1903352	L-ornithine transmembrane transport	IBA	biological process
GO:0015189	L-lysine transmembrane transporter activity	IBA	molecular function
GO:0015181	arginine transmembrane transporter activity	IBA	molecular function
GO:0006865	amino acid transport	IBA	biological process
GO:0097638	L-arginine import across plasma membrane	IBA	biological process
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0000064	L-ornithine transmembrane transporter activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006865	amino acid transport	IEA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006865	amino acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0006865	amino acid transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015181	arginine transmembrane transporter activity	IEA	molecular function
GO:0015809	arginine transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:1903401	L-lysine transmembrane transport	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq