• Gene id: 653857

Gene Summary

• Gene Symbol: ACTR3C   Gene   UCSC   Ensembl
• Aliases: ARP11
• Gene name: actin related protein 3C
• Alternate names: actin-related protein 3C, ARP3 actin related protein 3 homolog C, actin-related Arp11, actin-related protein 11,
• Gene location: 7q36.1 (150323668: 149881358)     Exons: 23     NC_000007.14
• OMIM: 602607

Protein Summary

• Protein general information: Q9C0K3  
  • Name: Actin related protein 3C (Actin related protein 11)
  • Length: 210  
  • Mass: 23712
  • Tissue specificity: Expressed in kidney, stomach, spleen, bone marrow, uterus, testis, placenta, skeletal muscle, mammary gland, lung, fetal liver, and fetal kidney, but not detected in small intestine, brain, and thymus. Expressed in low-metastatic lung
• Sequence:

  MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFI
  QQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPQKWIKQYTGINAINQKKFVIDVGYERFLGP
  EIFFHPEFANPDSMESISDVVDEVIQNCPIDVRRPLYKMEQIPLSYPQGHGFHPLSPPFH

• Structural information:
  • Interpro: IPR004000  IPR015623  
  • STRING: ENSP00000252071
• Other Databases: GeneCards:  ACTR3C  Malacards:  ACTR3C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	contributes to
GO:0005885	Arp2/3 protein complex	IEA	cellular component
GO:0007015	actin filament organization	IEA	biological process
GO:0034314	Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction
hsa05135	Yersinia infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq