• Gene id: 653784

Gene Summary

• Gene Symbol: MZT2A   Gene   UCSC   Ensembl
• Aliases: FAM128A, MOZART2A
• Gene name: mitotic spindle organizing protein 2A
• Alternate names: mitotic-spindle organizing protein 2A, family with sequence similarity 128, member A, mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2A,
• Gene location: 2q21.1 (131493079: 131469723)     Exons: 9     NC_000002.12
• OMIM: 613449

Protein Summary

• Protein general information: Q6P582  
  • Name: Mitotic spindle organizing protein 2A (Mitotic spindle organizing protein associated with a ring of gamma tubulin 2A)
  • Length: 158  
  • Mass: 16221
• Sequence:

  MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQM
  LKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPG
  KSPTQGST

• Structural information:
  • Interpro: IPR024332  
  • STRING: ENSP00000311500
• Other Databases: GeneCards:  MZT2A  Malacards:  MZT2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005819	spindle	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0008274	gamma-tubulin ring complex	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0008274	gamma-tubulin ring complex	ISS	cellular component
GO:0005813	centrosome	ISS	cellular component
GO:0005819	spindle	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)