• Gene id: 653464

Gene Summary

• Gene Symbol: SRGAP2C   Gene   UCSC   Ensembl
• Aliases: SRGAP2P1
• Gene name: SLIT-ROBO Rho GTPase activating protein 2C
• Alternate names: SLIT-ROBO Rho GTPase-activating protein 2C, SLIT-ROBO Rho GTPase activating protein 2 pseudogene 1,
• Gene location: 1p11.2 (121184974: 121392873)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This locus encodes a member of the SLIT-ROBO Rho GTPase activating protein family. This human-specific locus resulted from segmental duplication of the SLIT-ROBO Rho GTPase activating protein 2B locus. The encoded protein lacks the GTPase activating prote
• OMIM: 614704

Protein Summary

• Protein general information: P0DJJ0  
  • Name: SLIT ROBO Rho GTPase activating protein 2C (SLIT ROBO Rho GTPase activating protein 2 pseudogene 1)
  • Length: 459  
  • Mass: 53484
  • Tissue specificity: Ubiquitously expressed with higher expression in cerebellum. Probably expressed in fetal and adult neurons (at protein level). {ECO
• Sequence:

  MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAEHFL
  AKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKWESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFKKSKEVGQQLQ
  DDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPCSPDSTANVRIEEKHVRRSSV
  KKIEKMKEKHQAKYTENKLKAIKAQNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAEL
  NLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQPVQSELVQRCQQLQS
  RLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSMESVKSTVSETFMSKPSIAKRRANQQETEQFY
  FTVRECYGF

• Structural information:
  • Protein Domains: (22..32-)
    (/note="F-BAR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01077"-)
  • Interpro: IPR027267  IPR031160  IPR001060  IPR030252  
  • Prosite: PS51741
  • STRING: ENSP00000478290
• Other Databases: GeneCards:  SRGAP2C  Malacards:  SRGAP2C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030336	negative regulation of cell migration	IBA	biological process
GO:0048365	Rac GTPase binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0061000	negative regulation of dendritic spine development	IDA	biological process
GO:0021816	extension of a leading process involved in cell motility in cerebral cortex radial glia guided migration	IDA	biological process
GO:2001224	positive regulation of neuron migration	IDA	biological process
GO:0051490	negative regulation of filopodium assembly	IDA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0007399	nervous system development	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)