• Gene id: 65267

Gene Summary

• Gene Symbol: WNK3   Gene   UCSC   Ensembl
• Aliases: PRKWNK3
• Gene name: WNK lysine deficient protein kinase 3
• Alternate names: serine/threonine-protein kinase WNK3, protein kinase with no lysine 3,
• Gene location: Xp11.22 (54358694: 54192822)     Exons: 25     NC_000023.11
• Gene summary(Entrez): This gene encodes a protein belonging to the 'with no lysine' family of serine-threonine protein kinases. These family members lack the catalytic lysine in subdomain II, and instead have a conserved lysine in subdomain I. This family member functions as a
• OMIM: 300358

Protein Summary

• Protein general information: Q9BYP7  
  • Name: Serine/threonine protein kinase WNK3 (EC 2.7.11.1) (Protein kinase lysine deficient 3) (Protein kinase with no lysine 3)
  • Length: 1800  
  • Mass: 198416
  • Tissue specificity: Expressed in brain, lung, kidney, liver and pancreas, and in fetal tissues including placenta, fetal brain, lung and kidney. Very low levels of expression were also detected in fetal heart, thymus, liver and spleen. Isoform 1 is brain-
• Sequence:

  MATDSGDPASTEDSEKPDGISFENRVPQVAATLTVEARLKEKNSTFSASGETVERKRFFRKSVEMTEDDKVAESS
  PKDERIKAAMNIPRVDKLPSNVLRGGQEVKYEQCSKSTSEISKDCFKEKNEKEMEEEAEMKAVATSPSGRFLKFD
  IELGRGAFKTVYKGLDTETWVEVAWCELQDRKLTKAEQQRFKEEAEMLKGLQHPNIVRFYDSWESILKGKKCIVL
  VTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATL
  MRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASFNKVTD
  PEVKEIIEGCIRQNKSERLSIRDLLNHAFFAEDTGLRVELAEEDDCSNSSLALRLWVEDPKKLKGKHKDNEAIEF
  SFNLETDTPEEVAYEMVKSGFFHESDSKAVAKSIRDRVTPIKKTREKKPAGCLEERRDSQCKSMGNVFPQPQNTT
  LPLAPAQQTGAECEETEVDQHVRQQLLQRKPQQHCSSVTGDNLSEAGAASVIHSDTSSQPSVAYSSNQTMGSQMV
  SNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPTVVSQPQVSPLTVQKV
  PQIKPVSQPVGAEQQAALLKPDLVRSLNQDVATTKENVSSPDNPSGNGKQDRIKQRRASCPRPEKGTKFQLTVLQ
  VSTSGDNMVECQLETHNNKMVTFKFDVDGDAPEDIADYMVEDNFVLESEKEKFVEELRAIVGQAQEILHVHFATE
  RATGVDSITVDSNSSQTGSSEQVQINSTSTQTSNESAPQSSPVGRWRFCINQTIRNRETQSPPSLQHSMSAVPGR
  HPLPSPKNTSNKEISRDTLLTIENNPCHRALFTSKSEHKDVVDGKISECASVETKQPAILYQVEDNRQIMAPVTN
  SSSYSTTSVRAVPAECEGLTKQASIFIPVYPCHQTASQADALMSHPGESTQTSGNSLTTLAFDQKPQTLSVQQPA
  MDAEFISQEGETTVNTEASSPKTVIPTQTPGLEPTTLQPTTVLESDGERPPKLEFADNRIKTLDEKLRNLLYQEH
  SISSIYPESQKDTQSIDSPFSSSAEDTLSCPVTEVIAISHCGIKDSPVQSPNFQQTGSKLLSNVAASQPANISVF
  KRDLNVITSVPSELCLHEMSSDASLPGDPEAYPAAVSSGGAIHLQTGGGYFGLSFTCPSLKNPISKKSWTRKLKS
  WAYRLRQSTSFFKRSKVRQVETEEMRSAIAPDPIPLTRESTADTRALNRCKAMSGSFQRGRFQVITIPQQQSAKM
  TSFGIEHISVFSETNHSSEEAFIKTAKSQLVEIEPATQNPKTSFSYEKLQALQETCKENKGVPKQGDNFLSFSAA
  CETDVSSVTPEKEFEETSATGSSMQSGSELLLKEREILTAGKQPSSDSEFSASLAGSGKSVAKTGPESNQCLPHH
  EEQAYAQTQSSLFYSPSSPMSSDDESEIEDEDLKVELQRLREKHIQEVVNLQTQQNKELQELYERLRSIKDSKTQ
  STEIPLPPASPRRPRSFKSKLRSRPQSLTHVDNGIVATGKSCLINELENPLCVESNAASCQQSPASKKGMFTDDL
  HKLVDDWTKEAVGNSLIKPSLNQLKQSQHKLETENWNKVSENTPSTMGYTSTWISSLSQIRGAVPTSLPQGLSLP
  SFPGPLSSYGMPHVCQYNAVAGAGYPVQWVGISGTTQQSVVIPAQSGGPFQPGMNMQAFPTSSVQNPATIPPGPK

• Structural information:
  • Protein Domains: (147..40-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR024678  IPR000719  IPR008271  
  • Prosite: PS50011 PS00108
  • PDB: 5NKP 5O1V 5O21 5O23 5O26 5O2B 5O2C
  • PDBsum: 5NKP 5O1V 5O21 5O23 5O26 5O2B 5O2C
  • STRING: ENSP00000346667
• Other Databases: GeneCards:  WNK3  Malacards:  WNK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006884	cell volume homeostasis	ISS	biological process
GO:0006884	cell volume homeostasis	IMP	biological process
GO:0007231	osmosensory signaling pathway	IMP	biological process
GO:1904062	regulation of cation transmembrane transport	ISS	biological process
GO:1904062	regulation of cation transmembrane transport	IMP	biological process
GO:0035633	maintenance of blood-brain barrier	ISS	biological process
GO:0018107	peptidyl-threonine phosphorylation	ISS	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0032414	positive regulation of ion transmembrane transporter activity	IBA	biological process
GO:0051928	positive regulation of calcium ion transport	IBA	biological process
GO:2000651	positive regulation of sodium ion transmembrane transporter activity	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0010766	negative regulation of sodium ion transport	IBA	biological process
GO:0019869	chloride channel inhibitor activity	IBA	molecular function
GO:0019870	potassium channel inhibitor activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0050801	ion homeostasis	IBA	biological process
GO:1903288	positive regulation of potassium ion import across plasma membrane	IBA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0090279	regulation of calcium ion import	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:2000651	positive regulation of sodium ion transmembrane transporter activity	IMP	biological process
GO:0051928	positive regulation of calcium ion transport	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0050801	ion homeostasis	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006884	cell volume homeostasis	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:1904062	regulation of cation transmembrane transport	IEA	biological process
GO:0090188	negative regulation of pancreatic juice secretion	IEA	biological process
GO:0035633	maintenance of blood-brain barrier	IEA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0010765	positive regulation of sodium ion transport	IDA	biological process
GO:0032414	positive regulation of ion transmembrane transporter activity	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IDA	biological process
GO:0005912	adherens junction	ISS	cellular component
GO:0005923	bicellular tight junction	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IDA	biological process
GO:2000651	positive regulation of sodium ion transmembrane transporter activity	IDA	biological process
GO:0019869	chloride channel inhibitor activity	IDA	molecular function
GO:0006468	protein phosphorylation	ISS	biological process
GO:0005524	ATP binding	ISS	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0035556	intracellular signal transduction	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Nonobstructive azoospermia	MIK: 29790874

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29790874	Nonobstructive azoospermia	c.G4909A (p.Pro1637Ser)		37 familial cases, 75 individuals with idiopathic NOA, 74 fertile men	Male infertility	NGS
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881