• Gene id: 65264

Gene Summary

• Gene Symbol: UBE2Z   Gene   UCSC   Ensembl
• Aliases: HOYS7, USE1
• Gene name: ubiquitin conjugating enzyme E2 Z
• Alternate names: ubiquitin-conjugating enzyme E2 Z, E2 ubiquitin-conjugating enzyme Z, UBA6-specific enzyme E2, uba6-specific E2 conjugating enzyme 1, ubiquitin carrier protein Z, ubiquitin conjugating enzyme E2Z, ubiquitin-protein ligase Z,
• Gene location: 17q21.32 (48908406: 48929055)     Exons: 7     NC_000017.11
• Gene summary(Entrez): This gene encodes an enzyme which ubiquitinates proteins which participate in signaling pathways and apoptosis. [provided by RefSeq, Feb 2012]
• OMIM: 611362

Protein Summary

• Protein general information: Q9H832  
  • Name: Ubiquitin conjugating enzyme E2 Z (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme Z) (Uba6 specific E2 conjugating enzyme 1) (Use1) (Ubiquitin carrier protein Z) (Ubiquitin protein ligase Z)
  • Length: 354  
  • Mass: 38210
  • Tissue specificity: Widely expressed. Highly in placenta, pancreas, spleen and testis. {ECO
• Sequence:

  MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPPSAAAH
  GAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLF
  VFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNE
  PGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDP
  FGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV

• Structural information:
  • Interpro: IPR000608  IPR016135  
  • Prosite: PS50127
  • CDD: cd00195
  • PDB: 5A4P
  • PDBsum: 5A4P
  • STRING: ENSP00000354201
• Other Databases: GeneCards:  UBE2Z  Malacards:  UBE2Z

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0043065	positive regulation of apoptotic process	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881