• Gene id: 65263

Gene Summary

• Gene Symbol: PYCR3   Gene   UCSC   Ensembl
• Aliases: PYCRL
• Gene name: pyrroline-5-carboxylate reductase 3
• Alternate names: pyrroline-5-carboxylate reductase 3, P5C reductase 3, P5CR 3, pyrroline-5-carboxylate reductase-like,
• Gene location: 8q24.3 (143609574: 143603209)     Exons: 7     NC_000008.11
• Gene summary(Entrez): This gene encodes a protein that belongs to the pyrroline-5-carboxylate reductase family of enzymes. Members of this family catalyze the final step in proline biosynthesis, converting pyrroline-5-carboxylate to proline. Glutamate and ornithine are precurs
• OMIM: 601903

Protein Summary

• Protein general information: Q53H96  
  • Name: Pyrroline 5 carboxylate reductase 3 (P5C reductase 3) (P5CR 3) (EC 1.5.1.2) (Pyrroline 5 carboxylate reductase like protein)
  • Length: 274  
  • Mass: 28663
• Sequence:

  MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFA
  TKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMARGRHVGSSETK
  LLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAAQTLLGTAKMLLHEGQ
  HPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRK

• Structural information:
  • Interpro: IPR008927  IPR036291  IPR028939  IPR029036  IPR000304  
  • Prosite: PS00521
  • STRING: ENSP00000220966
• Other Databases: GeneCards:  PYCR3  Malacards:  PYCR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055129	L-proline biosynthetic process	IBA	biological process
GO:0004735	pyrroline-5-carboxylate reductase activity	IBA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0004735	pyrroline-5-carboxylate reductase activity	IDA	molecular function
GO:0055129	L-proline biosynthetic process	IDA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004735	pyrroline-5-carboxylate reductase activity	IEA	molecular function
GO:0006561	proline biosynthetic process	IEA	biological process
GO:0008652	cellular amino acid biosynthetic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0006561	proline biosynthetic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004735	pyrroline-5-carboxylate reductase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0008652	cellular amino acid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0055129	L-proline biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01230	Biosynthesis of amino acids
hsa00330	Arginine and proline metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881