• Gene id: 6517

Gene Summary

• Gene Symbol: SLC2A4   Gene   UCSC   Ensembl
• Aliases: GLUT4
• Gene name: solute carrier family 2 member 4
• Alternate names: solute carrier family 2, facilitated glucose transporter member 4, GLUT-4, glucose transporter type 4, insulin-responsive, insulin-responsive glucose transporter type 4, solute carrier family 2 (facilitated glucose transporter), member 4,
• Gene location: 17p13.1 (7281717: 7288256)     Exons: 11     NC_000017.11
• Gene summary(Entrez): This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is seque
• OMIM: 605246

Protein Summary

• Protein general information: P14672  
  • Name: Solute carrier family 2, facilitated glucose transporter member 4 (Glucose transporter type 4, insulin responsive) (GLUT 4)
  • Length: 509  
  • Mass: 54787
  • Tissue specificity: Skeletal and cardiac muscles; brown and white fat.
• Sequence:

  MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPG
  TLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLILGRFLIGAYSG
  LTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPE
  SPRYLYIIQNLEGPARKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
  SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGMCGCAILMTVALLLLE
  RVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFIIGMGFQYVAEAMGPYVF
  LLFAVLLLGFFIFTFLRVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND

• Structural information:
  • Interpro: IPR002441  IPR020846  IPR005828  IPR036259  IPR003663   IPR005829  
  • Prosite: PS50850 PS00216 PS00217
  • STRING: ENSP00000320935
• Other Databases: GeneCards:  SLC2A4  Malacards:  SLC2A4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0007614	short-term memory	ISS	biological process negative effect
GO:0007611	learning or memory	ISS	biological process
GO:0007616	long-term memory	ISS	biological process positive effect
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0042383	sarcolemma	ISS	cellular component
GO:0031550	positive regulation of brain-derived neurotrophic factor receptor signaling pathway	ISS	biological process
GO:0032869	cellular response to insulin stimulus	IBA	biological process
GO:0030136	clathrin-coated vesicle	IDA	cellular component
GO:0032593	insulin-responsive compartment	ISS	cellular component
GO:0012505	endomembrane system	ISS	cellular component
GO:0030659	cytoplasmic vesicle membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005355	glucose transmembrane transporter activity	ISS	molecular function
GO:1904659	glucose transmembrane transport	ISS	biological process
GO:0044381	glucose import in response to insulin stimulus	ISS	biological process
GO:0044381	glucose import in response to insulin stimulus	ISS	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0005355	glucose transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0005355	glucose transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0042593	glucose homeostasis	IDA	biological process
GO:0012506	vesicle membrane	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0055056	D-glucose transmembrane transporter activity	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0046323	glucose import	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032593	insulin-responsive compartment	IEA	cellular component
GO:0030315	T-tubule	IEA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005771	multivesicular body	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0071470	cellular response to osmotic stress	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0070062	extracellular exosome	IEA	cellular component
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032593	insulin-responsive compartment	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0030140	trans-Golgi network transport vesicle	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0098694	regulation of synaptic vesicle budding from presynaptic endocytic zone membrane	IEA	biological process
GO:0044381	glucose import in response to insulin stimulus	IEA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0031982	vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005355	glucose transmembrane transporter activity	IEA	molecular function
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0044381	glucose import in response to insulin stimulus	IEA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0010021	amylopectin biosynthetic process	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005355	glucose transmembrane transporter activity	IEA	molecular function
GO:0042593	glucose homeostasis	IDA	biological process
GO:0046323	glucose import	NAS	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0032593	insulin-responsive compartment	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0032869	cellular response to insulin stimulus	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0007614	short-term memory	ISS	biological process negative effect
GO:0007611	learning or memory	ISS	biological process
GO:0007616	long-term memory	ISS	biological process positive effect
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0042383	sarcolemma	ISS	cellular component
GO:0031550	positive regulation of brain-derived neurotrophic factor receptor signaling pathway	ISS	biological process
GO:0032869	cellular response to insulin stimulus	IBA	biological process
GO:0030136	clathrin-coated vesicle	IDA	cellular component
GO:0032593	insulin-responsive compartment	ISS	cellular component
GO:0012505	endomembrane system	ISS	cellular component
GO:0030659	cytoplasmic vesicle membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005355	glucose transmembrane transporter activity	ISS	molecular function
GO:1904659	glucose transmembrane transport	ISS	biological process
GO:0044381	glucose import in response to insulin stimulus	ISS	biological process
GO:0044381	glucose import in response to insulin stimulus	ISS	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0005355	glucose transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0005355	glucose transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0042593	glucose homeostasis	IDA	biological process
GO:0012506	vesicle membrane	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:1904659	glucose transmembrane transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0055056	D-glucose transmembrane transporter activity	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0046323	glucose import	IEA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032593	insulin-responsive compartment	IEA	cellular component
GO:0030315	T-tubule	IEA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005771	multivesicular body	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0071470	cellular response to osmotic stress	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0070062	extracellular exosome	IEA	cellular component
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032593	insulin-responsive compartment	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0030140	trans-Golgi network transport vesicle	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0098694	regulation of synaptic vesicle budding from presynaptic endocytic zone membrane	IEA	biological process
GO:0044381	glucose import in response to insulin stimulus	IEA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0031982	vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005355	glucose transmembrane transporter activity	IEA	molecular function
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0044381	glucose import in response to insulin stimulus	IEA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0010021	amylopectin biosynthetic process	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005355	glucose transmembrane transporter activity	IEA	molecular function
GO:0042593	glucose homeostasis	IDA	biological process
GO:0046323	glucose import	NAS	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0032593	insulin-responsive compartment	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0032869	cellular response to insulin stimulus	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:1904659	glucose transmembrane transport	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04910	Insulin signaling pathway
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04931	Insulin resistance
hsa04920	Adipocytokine signaling pathway
hsa04930	Type II diabetes mellitus

Diseases

Associated diseases	References
congestive heart failure	PMID:18778861
type 2 diabetes mellitus	PMID:1918382
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881