• Gene id: 65108

Gene Summary

• Gene Symbol: MARCKSL1   Gene   UCSC   Ensembl
• Aliases: F52, MACMARCKS, MLP, MLP1, MRP
• Gene name: MARCKS like 1
• Alternate names: MARCKS-related protein, MARCKS-like protein 1, mac-MARCKS, macrophage myristoylated alanine-rich C kinase substrate,
• Gene location: 1p35.1 (135054825: 134960377)     Exons: 20     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the myristoylated alanine-rich C-kinase substrate (MARCKS) family. Members of this family play a role in cytoskeletal regulation, protein kinase C signaling and calmodulin signaling. The encoded protein affects the formation
• OMIM: 602940

Protein Summary

• Protein general information: P49006  
  • Name: MARCKS related protein (MARCKS like protein 1) (Macrophage myristoylated alanine rich C kinase substrate) (Mac MARCKS) (MacMARCKS)
  • Length: 195  
  • Mass: 19529
• Sequence:

  MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPPSQGAE
  AKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPE
  SQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE

• Structural information:
  • Interpro: IPR002101  
  • Prosite: PS00826 PS00827
  • STRING: ENSP00000362638
• Other Databases: GeneCards:  MARCKSL1  Malacards:  MARCKSL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04666	Fc gamma R-mediated phagocytosis
hsa05140	Leishmaniasis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881