• Gene id: 6510

Gene Summary

• Gene Symbol: SLC1A5   Gene   UCSC   Ensembl
• Aliases: AAAT, ASCT2, ATBO, M7V1, M7VS1, R16, RDRC
• Gene name: solute carrier family 1 member 5
• Alternate names: neutral amino acid transporter B(0), ATB(0), RD114 virus receptor, RD114/simian type D retrovirus receptor, baboon M7 virus receptor, neutral amino acid transporter B, sodium-dependent neutral amino acid transporter type 2, solute carrier family 1 (neutral amino,
• Gene location: 19q13.32 (46788593: 46774882)     Exons: 10     NC_000019.10
• Gene summary(Entrez): The SLC1A5 gene encodes a sodium-dependent neutral amino acid transporter that can act as a receptor for RD114/type D retrovirus (Larriba et al., 2001 [PubMed 11781704]).[supplied by OMIM, Jan 2011]
• OMIM: 109190

Protein Summary

• Protein general information: Q15758  
  • Name: Neutral amino acid transporter B(0) (ATB(0)) (Baboon M7 virus receptor) (RD114/simian type D retrovirus receptor) (Sodium dependent neutral amino acid transporter type 2) (Solute carrier family 1 member 5)
  • Length: 541  
  • Mass: 56598
  • Tissue specificity: Placenta, lung, skeletal muscle, kidney, pancreas, and intestine.
• Sequence:

  MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGLGVSGA
  GGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLA
  LALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQE
  VEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIVEMEDVGLLFA
  RLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGTSSSSATLPLMMKCVEENNGVAKHIS
  RFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILEAVNLPV
  DHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYR
  GPAGDATVASEKESVM

• Structural information:
  • Interpro: IPR001991  IPR018107  IPR036458  
  • Prosite: PS00713 PS00714
  • PDB: 5LLM 5LLU 5LM4 5MJU 6GCT 6MP6 6MPB 6RVX 6RVY
  • PDBsum: 5LLM 5LLU 5LM4 5MJU 6GCT 6MP6 6MPB 6RVX 6RVY
  • STRING: ENSP00000444408
• Other Databases: GeneCards:  SLC1A5  Malacards:  SLC1A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015183	L-aspartate transmembrane transporter activity	ISS	molecular function
GO:0140009	L-aspartate import across plasma membrane	ISS	biological process
GO:0150104	transport across blood-brain barrier	ISS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0009925	basal plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070207	protein homotrimerization	IDA	biological process
GO:0015186	L-glutamine transmembrane transporter activity	IDA	molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0006868	glutamine transport	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0001618	virus receptor activity	IEA	molecular function
GO:0006865	amino acid transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0015175	neutral amino acid transmembrane transporter activity	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0015804	neutral amino acid transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0006865	amino acid transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903803	L-glutamine import across plasma membrane	IEA	biological process
GO:0015825	L-serine transport	IEA	biological process
GO:0015194	L-serine transmembrane transporter activity	IEA	molecular function
GO:0010585	glutamine secretion	IEA	biological process
GO:0015186	L-glutamine transmembrane transporter activity	TAS	molecular function
GO:0006868	glutamine transport	TAS	biological process
GO:0042470	melanosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption
hsa05230	Central carbon metabolism in cancer

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq