• Gene id: 65084

Gene Summary

• Gene Symbol: TMEM135   Gene   UCSC   Ensembl
• Aliases: PMP52
• Gene name: transmembrane protein 135
• Alternate names: transmembrane protein 135, peroxisomal membrane protein 52,
• Gene location: 11q14.2 (87037933: 87328823)     Exons: 17     NC_000011.10
• OMIM: 616360

Protein Summary

• Protein general information: Q86UB9  
  • Name: Transmembrane protein 135 (Peroxisomal membrane protein 52) (PMP52)
  • Length: 458  
  • Mass: 52291
• Sequence:

  MAALSKSIPHNCYEIGHTWHPSCRVSFLQITGGALEESLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFL
  TANGALYMAFFCILRKILGKFYSWTPGFGAALPASYVAILIERKSRRGLLTIYMANLATETLFRMGVARGTITTL
  RNGEVLLFCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPGRMNMIGL
  VRKFVDSICKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRHLFTQPSRLLSLFYNKENFQL
  GAFLGSFVSIYKGTSCFLRWIRNLDDELHAIIAGFLAGISMMFYKSTTISMYLASKLVETMYFKGIEAGKVPYFP
  HADTIIYSISTAICFQAAVMEVQTLRPSYWKFLLRLTKGKFAVMNRKVLDVFGTGASKHFQDFIPRLDPRYTTVT
  PELPTEFS

• Structural information:
  • Interpro: IPR026749  IPR031926  
  • STRING: ENSP00000306344
• Other Databases: GeneCards:  TMEM135  Malacards:  TMEM135

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005777	peroxisome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0090140	regulation of mitochondrial fission	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0032094	response to food	IEA	biological process
GO:0005811	lipid droplet	IEA	cellular component
GO:0007031	peroxisome organization	IEA	biological process
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0007031	peroxisome organization	ISS	biological process
GO:0005777	peroxisome	ISS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)