• Gene id: 65082

Gene Summary

• Gene Symbol: VPS33A   Gene   UCSC   Ensembl
• Aliases: MPSPS
• Gene name: VPS33A core subunit of CORVET and HOPS complexes
• Alternate names: vacuolar protein sorting-associated protein 33A, VPS33A, CORVET/HOPS core subunit, vacuolar protein sorting 33 homolog A, vacuolar protein sorting 33A,
• Gene location: 12q24.31 (122266493: 122229563)     Exons: 14     NC_000012.12
• Gene summary(Entrez): This gene encodes a tethering protein and a core subunit of the homotypic fusion and protein sorting (HOPS) complex. The HOPS complex and a second endosomal tethering complex called the class C core vacuole/endosome tethering (CORVET) complex, perform div
• OMIM: 603009

Protein Summary

• Protein general information: Q96AX1  
  • Name: Vacuolar protein sorting associated protein 33A (hVPS33A)
  • Length: 596  
  • Mass: 67611
• Sequence:

  MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAAD
  VKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGD
  LLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFD
  NLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIR
  DKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLT
  VEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKA
  GLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEE
  RQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF

• Structural information:
  • Interpro: IPR027482  IPR001619  IPR036045  IPR027121  
  • PDB: 4BX8 4BX9
  • PDBsum: 4BX8 4BX9
  • STRING: ENSP00000267199
• Other Databases: GeneCards:  VPS33A  Malacards:  VPS33A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0005764	lysosome	IBA	cellular component
GO:0033263	CORVET complex	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0030123	AP-3 adaptor complex	IDA	colocalizes with
GO:0071439	clathrin complex	IDA	colocalizes with
GO:0030897	HOPS complex	IDA	cellular component
GO:0030897	HOPS complex	IDA	cellular component
GO:0035751	regulation of lysosomal lumen pH	IMP	biological process
GO:0008333	endosome to lysosome transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005776	autophagosome	ISS	cellular component
GO:0097352	autophagosome maturation	IMP	biological process
GO:0097352	autophagosome maturation	IMP	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0006904	vesicle docking involved in exocytosis	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0016192	vesicle-mediated transport	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0030136	clathrin-coated vesicle	IEA	cellular component
GO:0030897	HOPS complex	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0032418	lysosome localization	IDA	biological process
GO:0032400	melanosome localization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048070	regulation of developmental pigmentation	ISS	biological process
GO:0030220	platelet formation	ISS	biological process
GO:0005765	lysosomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Mucopolysaccharidosis-plus syndrome	KEGG:H02205
Mucopolysaccharidosis-plus syndrome	KEGG:H02205
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881