• Gene id: 65078

Gene Summary

• Gene Symbol: RTN4R   Gene   UCSC   Ensembl
• Aliases: NGR, NOGOR
• Gene name: reticulon 4 receptor
• Alternate names: reticulon-4 receptor, Nogo-66 receptor, UNQ330/PRO526, nogo receptor,
• Gene location: 22q11.21 (20268317: 20241414)     Exons: 2     NC_000022.11
• Gene summary(Entrez): This gene encodes the receptor for reticulon 4, oligodendrocyte myelin glycoprotein and myelin-associated glycoprotein. This receptor mediates axonal growth inhibition and may play a role in regulating axonal regeneration and plasticity in the adult centr
• OMIM: 605566

Protein Summary

• Protein general information: Q9BZR6  
  • Name: Reticulon 4 receptor (Nogo receptor) (NgR) (Nogo 66 receptor)
  • Length: 473  
  • Mass: 50708
  • Tissue specificity: Widespread in the brain but highest levels in the gray matter. Low levels in heart and kidney; not expressed in oligodendrocytes (white matter). {ECO
• Sequence:

  MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQRIFLHGNRISHVPAA
  SFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLF
  RGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDL
  GRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCSLPQRLAGRDLKR
  LAANDLQGCAVATGPYHPIWTGRATDEEPLGLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDSPPGNGSG
  PRHINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGCSRKNRTRSHCRLGQAGSGGGGTGDSEGSGAL
  PSLTCSLTPLGLALVLWTVLGPC

• Structural information:
  • Protein Domains: (27..5-)
    (/note="LRRNT-)
    (260..31-)
    (/note="LRRCT-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • PDB: 1OZN 1P8T
  • PDBsum: 1OZN 1P8T
  • STRING: ENSP00000043402
• Other Databases: GeneCards:  RTN4R  Malacards:  RTN4R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:1905573	ganglioside GM1 binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:1905576	ganglioside GT1b binding	IDA	molecular function
GO:0044295	axonal growth cone	ISS	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0030517	negative regulation of axon extension	ISS	biological process
GO:0023041	neuronal signal transduction	ISS	biological process
GO:0045121	membrane raft	ISS	cellular component
GO:0038023	signaling receptor activity	ISS	molecular function
GO:0035374	chondroitin sulfate binding	ISS	molecular function
GO:0048681	negative regulation of axon regeneration	ISS	biological process
GO:0043025	neuronal cell body	ISS	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0038131	neuregulin receptor activity	ISS	molecular function
GO:0043547	positive regulation of GTPase activity	ISS	biological process
GO:0043198	dendritic shaft	ISS	cellular component
GO:0022038	corpus callosum development	ISS	biological process
GO:0031362	anchored component of external side of plasma membrane	IMP	cellular component
GO:0035025	positive regulation of Rho protein signal transduction	IMP	biological process
GO:0007166	cell surface receptor signaling pathway	ISS	biological process
GO:0008201	heparin binding	ISS	molecular function
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050771	negative regulation of axonogenesis	TAS	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0048681	negative regulation of axon regeneration	IEA	biological process
GO:0044295	axonal growth cone	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0035374	chondroitin sulfate binding	IEA	molecular function
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0023041	neuronal signal transduction	IEA	biological process
GO:0098793	presynapse	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0038131	neuregulin receptor activity	IEA	molecular function
GO:0030426	growth cone	IEA	cellular component
GO:0022038	corpus callosum development	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0007409	axonogenesis	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0038023	signaling receptor activity	NAS	molecular function

Diseases

Associated diseases	References
Schizophrenia	KEGG:H01649
Schizophrenia	KEGG:H01649
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R