• Gene id: 6507

Gene Summary

• Gene Symbol: SLC1A3   Gene   UCSC   Ensembl
• Aliases: EA6, EAAT1, GLAST, GLAST1
• Gene name: solute carrier family 1 member 3
• Alternate names: excitatory amino acid transporter 1, GLAST-1, sodium-dependent glutamate/aspartate transporter 1, solute carrier family 1 (glial high affinity glutamate transporter), member 3,
• Gene location: 5p13.2 (36606354: 36688333)     Exons: 12     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of a member of a high affinity glutamate transporter family. This gene functions in the termination of excitatory neurotransmission in central nervous system. Mutations are associated with episodic ataxia, Type 6. Alternative sp
• OMIM: 600111

Protein Summary

• Protein general information: P43003  
  • Name: Excitatory amino acid transporter 1 (Sodium dependent glutamate/aspartate transporter 1) (GLAST 1) (Solute carrier family 1 member 3)
  • Length: 542  
  • Mass: 59572
  • Tissue specificity: Detected in brain (PubMed
• Sequence:

  MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIVGTILGFTLRPYRMSY
  REVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMGMRAVVYYMTTTIIAVVIGIIIVIIIHPGKG
  TKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLT
  RITEELVPVPGSVNGVNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGK
  IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITALGTSSSSATLPITFKC
  LEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFELNFGQIITISITATAASIGAAGIPQAGLVT
  MVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQL
  IAQDNETEKPIDSETKM

• Structural information:
  • Interpro: IPR001991  IPR018107  IPR036458  
  • Prosite: PS00713 PS00714
  • PDB: 5LLM 5LLU 5LM4 5MJU
  • PDBsum: 5LLM 5LLU 5LM4 5MJU
  • STRING: ENSP00000265113
• Other Databases: GeneCards:  SLC1A3  Malacards:  SLC1A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098796	membrane protein complex	ISS	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0031410	cytoplasmic vesicle	ISS	cellular component
GO:0150104	transport across blood-brain barrier	ISS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0070633	transepithelial transport	ISS	biological process
GO:0009925	basal plasma membrane	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0015501	glutamate:sodium symporter activity	IDA	molecular function
GO:1902476	chloride transmembrane transport	IDA	biological process
GO:0005314	high-affinity glutamate transmembrane transporter activity	IDA	molecular function
GO:0140009	L-aspartate import across plasma membrane	IDA	biological process
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0098712	L-glutamate import across plasma membrane	IDA	biological process
GO:0015813	L-glutamate transmembrane transport	IDA	biological process
GO:0005314	high-affinity glutamate transmembrane transporter activity	IMP	molecular function
GO:0070779	D-aspartate import across plasma membrane	IMP	biological process
GO:0070779	D-aspartate import across plasma membrane	IMP	biological process
GO:0005314	high-affinity glutamate transmembrane transporter activity	IMP	molecular function
GO:0015501	glutamate:sodium symporter activity	IMP	molecular function
GO:0098712	L-glutamate import across plasma membrane	IMP	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0140009	L-aspartate import across plasma membrane	IMP	biological process
GO:0098712	L-glutamate import across plasma membrane	IMP	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006865	amino acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0001504	neurotransmitter uptake	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0014047	glutamate secretion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071944	cell periphery	IEA	cellular component
GO:0070779	D-aspartate import across plasma membrane	IEA	biological process
GO:0050885	neuromuscular process controlling balance	IEA	biological process
GO:0050806	positive regulation of synaptic transmission	IEA	biological process
GO:0046677	response to antibiotic	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0031223	auditory behavior	IEA	biological process
GO:0016597	amino acid binding	IEA	molecular function
GO:0016595	glutamate binding	IEA	molecular function
GO:0009611	response to wounding	IEA	biological process
GO:0005314	high-affinity glutamate transmembrane transporter activity	IEA	molecular function
GO:0051938	L-glutamate import	IEA	biological process
GO:0048667	cell morphogenesis involved in neuron differentiation	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0021545	cranial nerve development	IEA	biological process
GO:0015813	L-glutamate transmembrane transport	IEA	biological process
GO:0015172	acidic amino acid transmembrane transporter activity	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0009449	gamma-aminobutyric acid biosynthetic process	IEA	biological process
GO:0009416	response to light stimulus	IEA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005313	L-glutamate transmembrane transporter activity	IDA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0070779	D-aspartate import across plasma membrane	IDA	biological process
GO:0051938	L-glutamate import	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease
hsa04724	Glutamatergic synapse
hsa04721	Synaptic vesicle cycle

Diseases

Associated diseases	References
Episodic ataxias	KEGG:H00749
Episodic ataxias	KEGG:H00749
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)