• Gene id: 65061

Gene Summary

• Gene Symbol: CDK15   Gene   UCSC   Ensembl
• Aliases: ALS2CR7, PFTAIRE2, PFTK2
• Gene name: cyclin dependent kinase 15
• Alternate names: cyclin-dependent kinase 15, PFTAIRE protein kinase 2, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 7, amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein, cell division protein kinase 15, serine/threonine prot,
• Gene location: 2q33.1 (75261878: 75266375)     Exons: 5     NC_000017.11
• OMIM: 616147

Protein Summary

• Protein general information: Q96Q40  
  • Name: Cyclin dependent kinase 15 (EC 2.7.11.22) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein) (Cell division protein kinase 15) (Serine/threonine protein kinase ALS2CR7) (Serine/threonine protein kinase PFTAIRE 2)
  • Length: 435  
  • Mass: 49023
• Sequence:

  MGQELCAKTVQPGCSCYHCSEGGEAHSCRRSQPETTEAAFKLTDLKEASCSMTSFHPRGLQAARAQKFKSKRPRS
  NSDCFQEEDLRQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKGISRINGQLVALKVISMNAEEGVPFTAIREA
  SLLKGLKHANIVLLHDIIHTKETLTFVFEYMHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDL
  KPQNLLISHLGELKLADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLF
  PGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVVWNRLGRVPEAEDLASQMLKGFPRDR
  VSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLASYQKGHHPAQFSKCW

• Structural information:
  • Protein Domains: (103..38-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR042761  IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • CDD: cd07870
  • STRING: ENSP00000406472
• Other Databases: GeneCards:  CDK15  Malacards:  CDK15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	IBA	biological process
GO:0030332	cyclin binding	IBA	molecular function
GO:0006468	protein phosphorylation	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray