• Gene id: 6504

Gene Summary

• Gene Symbol: SLAMF1   Gene   UCSC   Ensembl
• Aliases: CD150, CDw150, SLAM
• Gene name: signaling lymphocytic activation molecule family member 1
• Alternate names: signaling lymphocytic activation molecule, IPO-3, SLAM family member 1,
• Gene location: 1q23.3 (160647310: 160608099)     Exons: 8     NC_000001.11
• OMIM: 607294

Protein Summary

• Protein general information: Q13291  
  • Name: Signaling lymphocytic activation molecule (CDw150) (IPO 3) (SLAM family member 1) (CD antigen CD150)
  • Length: 335  
  • Mass: 37231
  • Tissue specificity: Constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation (PubMed
• Sequence:

  MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVE
  NKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLN
  KTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPW
  PGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQ
  DPCTTIYVAATEPVPESVQETNSITVYASVTLPES

• Structural information:
  • Protein Domains: (29..13-)
    (/note="Ig-like-V-type)
    (144..22-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR010407  
  • Prosite: PS50835
  • PDB: 1D4T 1D4W 1I3Z 1KA6 1KA7 1M27 2DZF 2IE9 2IFL 2IG5
  • PDBsum: 1D4T 1D4W 1I3Z 1KA6 1KA7 1M27 2DZF 2IE9 2IFL 2IG5
  • DIP: 40767
  • STRING: ENSP00000306190
• Other Databases: GeneCards:  SLAMF1  Malacards:  SLAMF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032695	negative regulation of interleukin-12 production	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0002277	myeloid dendritic cell activation involved in immune response	IDA	biological process
GO:2000349	negative regulation of CD40 signaling pathway	IDA	biological process
GO:0032715	negative regulation of interleukin-6 production	IDA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0046649	lymphocyte activation	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0006909	phagocytosis	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0003823	antigen binding	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0042169	SH2 domain binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05162	Measles

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881