• Gene id: 6503

Gene Summary

• Gene Symbol: SLA   Gene   UCSC   Ensembl
• Aliases: SLA1, SLAP
• Gene name: Src like adaptor
• Alternate names: src-like-adapter, SLAP-1, hSLAP, src-like-adapter protein 1,
• Gene location: 8q24.22 (133103052: 133036727)     Exons: 9     NC_000008.11
• OMIM: 612125

Protein Summary

• Protein general information: Q13239  
  • Name: Src like adapter (Src like adapter protein 1) (SLAP 1) (hSLAP)
  • Length: 276  
  • Mass: 31156
  • Tissue specificity: Expressed in lung and fetal brain. Weakly expressed in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas. {ECO
• Sequence:

  MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGI
  CVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTF
  QCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLF
  SYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED

• Structural information:
  • Protein Domains: (22..8-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (84..17-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR000980  IPR036860  IPR036028  IPR001452  IPR035055   IPR035052  IPR035596  
  • Prosite: PS50001 PS50002
  • CDD: cd10344 cd12010
  • PDB: 2CUD
  • PDBsum: 2CUD
  • STRING: ENSP00000394049
• Other Databases: GeneCards:  SLA  Malacards:  SLA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IBA	molecular function
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq