• Gene id: 6502

Gene Summary

• Gene Symbol: SKP2   Gene   UCSC   Ensembl
• Aliases: FBL1, FBXL1, FLB1, p45
• Gene name: S-phase kinase associated protein 2
• Alternate names: S-phase kinase-associated protein 2, CDK2/cyclin A-associated protein p45, F-box/LRR-repeat protein 1, S-phase kinase-associated protein 2, E3 ubiquitin protein ligase, p45skp2,
• Gene location: 5p13.2 (36152042: 36184318)     Exons: 4     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w
• OMIM: 601436

Protein Summary

• Protein general information: Q13309  
  • Name: S phase kinase associated protein 2 (Cyclin A/CDK2 associated protein p45) (F box protein Skp2) (F box/LRR repeat protein 1) (p45skp2)
  • Length: 424  
  • Mass: 47761
• Sequence:

  MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGS
  DKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPD
  VTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNT
  LAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
  DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGT
  LQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

• Structural information:
  • Protein Domains: (94..14-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  IPR006553  IPR032675  
  • Prosite: PS50181
  • PDB: 1FQV 1FS1 1FS2 1LDK 2ASS 2AST
  • PDBsum: 1FQV 1FS1 1FS2 1LDK 2ASS 2AST
  • DIP: 17011
  • STRING: ENSP00000274255
• Other Databases: GeneCards:  SKP2  Malacards:  SKP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051726	regulation of cell cycle	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0000086	G2/M transition of mitotic cell cycle	IBA	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0070936	protein K48-linked ubiquitination	IMP	biological process
GO:0045087	innate immune response	IMP	biological process
GO:0051607	defense response to virus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	IEA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0033148	positive regulation of intracellular estrogen receptor signaling pathway	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:1902916	positive regulation of protein polyubiquitination	IEA	biological process
GO:0071460	cellular response to cell-matrix adhesion	IEA	biological process
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0019005	SCF ubiquitin ligase complex	IEA	cellular component
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa04120	Ubiquitin mediated proteolysis
hsa04150	mTOR signaling pathway
hsa04110	Cell cycle
hsa04068	FoxO signaling pathway
hsa05222	Small cell lung cancer

Diseases

Associated diseases	References
Endometrial hyperplasia	PMID:16080017
Prostate cancer	PMID:19450994
Prostate cancer	PMID:12670908
Breast cancer	PMID:19350629
Transitional cell carcinoma	PMID:15351619
renal cell carcinoma	PMID:18922157
lung small cell carcinoma	PMID:12107105
cervix uteri carcinoma in situ	PMID:19094580
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881