• Gene id: 65010

Gene Summary

• Gene Symbol: SLC26A6   Gene   UCSC   Ensembl
• Gene name: solute carrier family 26 member 6
• Alternate names: solute carrier family 26 member 6, anion exchange transporter, anion transporter 1, pendrin L1, solute carrier family 26 (anion exchanger), member 6, sulfate anion transporter,
• Gene location: 3p21.31 (48635460: 48625722)     Exons: 21     NC_000003.12
• Gene summary(Entrez): This gene belongs to the solute carrier 26 family, whose members encode anion transporter proteins. This particular family member encodes a protein involved in transporting chloride, oxalate, sulfate and bicarbonate. Alternatively spliced transcript varia

Protein Summary

• Protein general information: Q9BXS9  
  • Name: Solute carrier family 26 member 6 (Anion exchange transporter) (Pendrin like protein 1) (Pendrin L1)
  • Length: 759  
  • Mass: 82967
  • Tissue specificity: Ubiquitous. Highest levels in kidney and pancreas. Lower expression in heart, skeletal muscle, liver and placenta. Also found in lung and brain. Isoform 4 is ubiquitously expressed. Isoform 6 is expressed in heart, brain, placenta, lun
• Sequence:

  MGLADASGPRDTQALLSATQAMDLRRRDYHMERPLLNQEHLEELGRWGSAPRTHQWRTWLQCSRARAYALLLQHL
  PVLVWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPVFGLYSSFYPVFIYFLFGTSRHISVGTFAVM
  SVMVGSVTESLAPQALNDSMINETARDAARVQVASTLSVLVGLFQVGLGLIHFGFVVTYLSEPLVRGYTTAAAVQ
  VFVSQLKYVFGLHLSSHSGPLSLIYTVLEVCWKLPQSKVGTVVTAAVAGVVLVVVKLLNDKLQQQLPMPIPGELL
  TLIGATGISYGMGLKHRFEVDVVGNIPAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAISLGKIFALRHGYRVD
  SNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGAISSLFILLIIVKLGELFHDLPKAVLAAIII
  VNLKGMLRQLSDMRSLWKANRADLLIWLVTFTATILLNLDLGLVVAVIFSLLLVVVRTQMPHYSVLGQVPDTDIY
  RDVAEYSEAKEVRGVKVFRSSATVYFANAEFYSDALKQRCGVDVDFLISQKKKLLKKQEQLKLKQLQKEEKLRKQ
  AASPKGASVSINVNTSLEDMRSNNVEDCKMMQVSSGDKMEDATANGQEDSKAPDGSTLKALGLPQPDFHSLILDL
  GALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGHFFDASITKKHLFASVHDAVTFALQHPRPVP
  DSPVSVTRL

• Structural information:
  • Protein Domains: (530..74-)
    (/note="STAS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00198"-)
  • Interpro: IPR018045  IPR011547  IPR001902  IPR030323  IPR002645   IPR036513  
  • Prosite: PS01130 PS50801
  • STRING: ENSP00000378920
• Other Databases: GeneCards:  SLC26A6  Malacards:  SLC26A6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015106	bicarbonate transmembrane transporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0019531	oxalate transmembrane transporter activity	IBA	molecular function
GO:0015301	anion:anion antiporter activity	IBA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IBA	molecular function
GO:0015108	chloride transmembrane transporter activity	IBA	molecular function
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0031526	brush border membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:2001150	positive regulation of dipeptide transmembrane transport	ISS	biological process
GO:0097225	sperm midpiece	ISS	cellular component
GO:0071320	cellular response to cAMP	ISS	biological process
GO:0070633	transepithelial transport	ISS	biological process
GO:0051454	intracellular pH elevation	ISS	biological process
GO:0042045	epithelial fluid transport	ISS	biological process
GO:0030321	transepithelial chloride transport	IMP	biological process
GO:0030321	transepithelial chloride transport	ISS	biological process
GO:0019532	oxalate transport	IMP	biological process
GO:0019532	oxalate transport	ISS	biological process
GO:0019531	oxalate transmembrane transporter activity	IMP	molecular function
GO:0015724	formate transport	ISS	biological process
GO:0015301	anion:anion antiporter activity	IMP	molecular function
GO:0015301	anion:anion antiporter activity	ISS	molecular function
GO:0015116	sulfate transmembrane transporter activity	IMP	molecular function
GO:0015108	chloride transmembrane transporter activity	IMP	molecular function
GO:0015108	chloride transmembrane transporter activity	ISS	molecular function
GO:0012506	vesicle membrane	ISS	cellular component
GO:0006821	chloride transport	IMP	biological process
GO:0071332	cellular response to fructose stimulus	ISS	biological process
GO:0051453	regulation of intracellular pH	IMP	biological process
GO:0050892	intestinal absorption	ISS	biological process
GO:0048240	sperm capacitation	ISS	biological process
GO:0046724	oxalic acid secretion	ISS	biological process
GO:0031982	vesicle	ISS	cellular component
GO:0030165	PDZ domain binding	ISS	molecular function
GO:0016020	membrane	ISS	cellular component
GO:0015797	mannitol transport	ISS	biological process
GO:0015701	bicarbonate transport	IMP	biological process
GO:0015660	formate efflux transmembrane transporter activity	ISS	molecular function
GO:0015499	formate transmembrane transporter activity	ISS	molecular function
GO:0015562	efflux transmembrane transporter activity	ISS	molecular function
GO:0015499	formate transmembrane transporter activity	ISS	molecular function
GO:0015106	bicarbonate transmembrane transporter activity	IMP	molecular function
GO:0015106	bicarbonate transmembrane transporter activity	ISS	molecular function
GO:0008272	sulfate transport	IMP	biological process
GO:0008272	sulfate transport	ISS	biological process
GO:0006820	anion transport	IEA	biological process
GO:0008509	anion transmembrane transporter activity	IEA	molecular function
GO:0015116	sulfate transmembrane transporter activity	IEA	molecular function
GO:0015301	anion:anion antiporter activity	IEA	molecular function
GO:0051454	intracellular pH elevation	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0008271	secondary active sulfate transmembrane transporter activity	IEA	molecular function
GO:0008272	sulfate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0015297	antiporter activity	IEA	molecular function
GO:0015301	anion:anion antiporter activity	IEA	molecular function
GO:0034707	chloride channel complex	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006821	chloride transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005254	chloride channel activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:1902358	sulfate transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:0098656	anion transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process
GO:1902476	chloride transmembrane transport	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq