• Gene id: 65009

Gene Summary

• Gene Symbol: NDRG4   Gene   UCSC   Ensembl
• Aliases: BDM1, SMAP-8, SMAP8
• Gene name: NDRG family member 4
• Alternate names: protein NDRG4, N-myc downstream-regulated gene 4 protein, brain development-related molecule 1, smooth muscle-associated protein 8, vascular smooth muscle cell-associated protein 8,
• Gene location: 16q21 (102317376: 102343173)     Exons: 14     NC_000014.9
• Gene summary(Entrez): This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes an
• OMIM: 614463

Protein Summary

• Protein general information: Q9ULP0  
  • Name: Protein NDRG4 (Brain development related molecule 1) (N myc downstream regulated gene 4 protein) (Vascular smooth muscle cell associated protein 8) (SMAP 8)
  • Length: 352  
  • Mass: 38459
  • Tissue specificity: Expressed predominantly in brain and heart (at protein level). In the brain, detected in astrocytes. Isoform 1 and isoform 2 are only expressed in brain. Isoform 3 is expressed in both heart and brain. Up-regulated in glioblastoma mult
• Sequence:

  MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQV
  GASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWA
  ATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTL
  RCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIAYLKDRRLSGG
  AVPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEVSC

• Structural information:
  • Interpro: IPR029058  IPR004142  IPR030695  
  • STRING: ENSP00000377823
• Other Databases: GeneCards:  NDRG4  Malacards:  NDRG4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0007420	brain development	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048278	vesicle docking	IEA	biological process
GO:0031253	cell projection membrane	IEA	cellular component
GO:2001135	regulation of endocytic recycling	IEA	biological process
GO:0060973	cell migration involved in heart development	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001947	heart looping	ISS	biological process
GO:0035050	embryonic heart tube development	ISS	biological process
GO:0060038	cardiac muscle cell proliferation	ISS	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0010642	negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0014912	negative regulation of smooth muscle cell migration	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0048662	negative regulation of smooth muscle cell proliferation	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0010976	positive regulation of neuron projection development	ISS	biological process
GO:0005739	mitochondrion	ISS	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0030154	cell differentiation	NAS	biological process
GO:0030154	cell differentiation	NAS	biological process
GO:0005737	cytoplasm	NAS	cellular component

Diseases

Associated diseases	References
Glioblastoma multiforme	PMID:22489821
Malignant glioma	PMID:22399192
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)