Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 6500
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol SKP1   Gene   UCSC   Ensembl
Aliases EMC19, OCP-II, OCP2, SKP1A, TCEB1L, p19A
Gene name S-phase kinase associated protein 1
Alternate names S-phase kinase-associated protein 1, OCP-2, RNA polymerase II elongation factor-like protein OCP2, SIII, cyclin A/CDK2-associated p19, cyclin-A/CDK2-associated protein p19, organ of Corti protein 2, organ of Corti protein II, p19skp1, transcription elongation fact,
Gene location 5q31.1 (134177032: 134148934)     Exons: 5     NC_000005.10
Gene summary(Entrez) This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are inv
OMIM 601434

Protein Summary
Protein general information P63208  

Name: S phase kinase associated protein 1 (Cyclin A/CDK2 associated protein p19) (p19A) (Organ of Corti protein 2) (OCP 2) (Organ of Corti protein II) (OCP II) (RNA polymerase II elongation factor like protein) (SIII) (Transcription elongation factor B polypept

Length: 163  Mass: 18658

Sequence MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDD
ENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEE
AQVRKENQWCEEK
Structural information
Interpro:  IPR016897  IPR001232  IPR036296  IPR011333  IPR016072  
IPR016073  

PDB:  		 1FQV 1FS1 1FS2 1LDK 1P22 2ASS 2AST 2E31 2E32 2OVP 2OVQ 2OVR 3L2O 3WSO 4I6J 5IBK 5JH5 5K35 5V4B 5VZT 5VZU 5XYL 6BVA 6BYH 6C16 6M90 6M91 6M92 6M93 6M94 6O60
PDBsum:   1FQV 1FS1 1FS2 1LDK 1P22 2ASS 2AST 2E31 2E32 2OVP 2OVQ 2OVR 3L2O 3WSO 4I6J 5IBK 5JH5 5K35 5V4B 5VZT 5VZU 5XYL 6BVA 6BYH 6C16 6M90 6M91 6M92 6M93 6M94 6O60

DIP:  
31606
MINT:  
STRING:   ENSP00000231487
Other Databases GeneCards:  SKP1  Malacards:  SKP1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:1990756 ubiquitin ligase-substrat
e adaptor activity
 IDA molecular function
GO:0008013 beta-catenin binding
 IDA molecular function
GO:1904668 positive regulation of ub
iquitin protein ligase ac
tivity
 IDA biological process
GO:0097602 cullin family protein bin
ding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005737 cytoplasm
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:1990444 F-box domain binding
 IPI molecular function
GO:0051457 maintenance of protein lo
cation in nucleus
 IPI biological process
GO:0000209 protein polyubiquitinatio
n
 IDA biological process
GO:0005634 nucleus
 IBA cellular component
GO:0005737 cytoplasm
 IBA cellular component
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 IBA biological process
GO:0097602 cullin family protein bin
ding
 IBA molecular function
GO:0035518 histone H2A monoubiquitin
ation
 IDA biological process
GO:0031519 PcG protein complex
 IDA colocalizes with
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 IDA biological process
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 IDA biological process
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0016567 protein ubiquitination
 IDA biological process
GO:0031467 Cul7-RING ubiquitin ligas
e complex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0006511 ubiquitin-dependent prote
in catabolic process
 IEA biological process
GO:0016032 viral process
 IEA biological process
GO:0000209 protein polyubiquitinatio
n
 TAS biological process
GO:0010265 SCF complex assembly
 TAS biological process
GO:0010972 negative regulation of G2
/M transition of mitotic
cell cycle
 TAS biological process
GO:0010972 negative regulation of G2
/M transition of mitotic
cell cycle
 TAS biological process
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 TAS biological process
GO:0038061 NIK/NF-kappaB signaling
 TAS biological process
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0070498 interleukin-1-mediated si
gnaling pathway
 TAS biological process
GO:0000086 G2/M transition of mitoti
c cell cycle
 TAS biological process
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
 TAS biological process
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0006879 cellular iron ion homeost
asis
 TAS biological process
GO:0016055 Wnt signaling pathway
 TAS biological process
GO:0038095 Fc-epsilon receptor signa
ling pathway
 TAS biological process
GO:0043687 post-translational protei
n modification
 TAS biological process
GO:0051403 stress-activated MAPK cas
cade
 TAS biological process
GO:1901990 regulation of mitotic cel
l cycle phase transition
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005829 cytosol
 IEA cellular component
GO:0005813 centrosome
 IEA cellular component
GO:0031467 Cul7-RING ubiquitin ligas
e complex
 IEA cellular component
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 IEA biological process
GO:0019005 SCF ubiquitin ligase comp
lex
 IEA cellular component
GO:0016567 protein ubiquitination
 IEA biological process
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019904 protein domain specific b
inding
 IPI molecular function
GO:0031467 Cul7-RING ubiquitin ligas
e complex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05200Pathways in cancer
hsa05131Shigellosis
hsa05132Salmonella infection
hsa05170Human immunodeficiency virus 1 infection
hsa04141Protein processing in endoplasmic reticulum
hsa04310Wnt signaling pathway
hsa04120Ubiquitin mediated proteolysis
hsa04110Cell cycle
hsa04114Oocyte meiosis
hsa04350TGF-beta signaling pathway
hsa04710Circadian rhythm

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract