• Gene id: 650

Gene Summary

• Gene Symbol: BMP2   Gene   UCSC   Ensembl
• Aliases: BDA2, BMP2A, SSFSC
• Gene name: bone morphogenetic protein 2
• Alternate names: bone morphogenetic protein 2, bone morphogenetic protein 2A,
• Gene location: 20p12.3 (6767685: 6780245)     Exons: 3     NC_000020.11
• Gene summary(Entrez): This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate

Protein Summary

• Protein general information: P12643  
  • Name: Bone morphogenetic protein 2 (BMP 2) (Bone morphogenetic protein 2A) (BMP 2A)
  • Length: 396  
  • Mass: 44702
  • Tissue specificity: Particularly abundant in lung, spleen and colon and in low but significant levels in heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, ovary and small intestine.
• Sequence:

  MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVV
  PPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAEL
  QVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHG
  FVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
  LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLD
  ENEKVVLKNYQDMVVEGCGCR

• Structural information:
  • Interpro: IPR029034  IPR001839  IPR001111  IPR015615  IPR017948  
  • Prosite: PS00250 PS51362
  • PDB: 1ES7 1REU 1REW 2GOO 2H62 2H64 2QJ9 2QJA 2QJB 3BK3 3BMP 4MID 4N1D 4UHY 4UHZ 4UI0 4UI1 4UI2 6OMN
  • PDBsum: 1ES7 1REU 1REW 2GOO 2H62 2H64 2QJ9 2QJA 2QJB 3BK3 3BMP 4MID 4N1D 4UHY 4UHZ 4UI0 4UI1 4UI2 6OMN
  • DIP: 5792
  • STRING: ENSP00000368104
• Other Databases: GeneCards:  BMP2  Malacards:  BMP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0045786	negative regulation of cell cycle	IDA	biological process
GO:0005125	cytokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0060395	SMAD protein signal transduction	IBA	biological process
GO:0070700	BMP receptor binding	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IBA	biological process
GO:0030509	BMP signaling pathway	IBA	biological process
GO:0000187	activation of MAPK activity	IDA	biological process
GO:1900745	positive regulation of p38MAPK cascade	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0051216	cartilage development	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0001503	ossification	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0001501	skeletal system development	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0070700	BMP receptor binding	IDA	molecular function
GO:0061036	positive regulation of cartilage development	IDA	biological process
GO:0045778	positive regulation of ossification	IDA	biological process
GO:0021537	telencephalon development	IDA	biological process
GO:0010922	positive regulation of phosphatase activity	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0001649	osteoblast differentiation	IDA	biological process
GO:0001649	osteoblast differentiation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0035051	cardiocyte differentiation	IDA	biological process
GO:0019211	phosphatase activator activity	IDA	molecular function
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001837	epithelial to mesenchymal transition	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0030509	BMP signaling pathway	IMP	biological process
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0051042	negative regulation of calcium-independent cell-cell adhesion	IDA	biological process
GO:0002062	chondrocyte differentiation	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEP	biological process
GO:0030509	BMP signaling pathway	IEP	biological process
GO:0030509	BMP signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0061036	positive regulation of cartilage development	IEA	biological process
GO:0060804	positive regulation of Wnt signaling pathway by BMP signaling pathway	IEA	biological process
GO:0060128	corticotropin hormone secreting cell differentiation	IEA	biological process
GO:0060039	pericardium development	IEA	biological process
GO:0055008	cardiac muscle tissue morphogenesis	IEA	biological process
GO:0045778	positive regulation of ossification	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0045165	cell fate commitment	IEA	biological process
GO:0035054	embryonic heart tube anterior/posterior pattern specification	IEA	biological process
GO:0033690	positive regulation of osteoblast proliferation	IEA	biological process
GO:0031648	protein destabilization	IEA	biological process
GO:0030501	positive regulation of bone mineralization	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0004745	retinol dehydrogenase activity	IEA	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:0001649	osteoblast differentiation	IEA	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IEA	biological process
GO:0072138	mesenchymal cell proliferation involved in ureteric bud development	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0060129	thyroid-stimulating hormone-secreting cell differentiation	IEA	biological process
GO:0055007	cardiac muscle cell differentiation	IEA	biological process
GO:0048839	inner ear development	IEA	biological process
GO:0048711	positive regulation of astrocyte differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0042487	regulation of odontogenesis of dentin-containing tooth	IEA	biological process
GO:0042482	positive regulation of odontogenesis	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0030509	BMP signaling pathway	IEA	biological process
GO:0030282	bone mineralization	IEA	biological process
GO:0021978	telencephalon regionalization	IEA	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006029	proteoglycan metabolic process	IEA	biological process
GO:0003203	endocardial cushion morphogenesis	IEA	biological process
GO:0003181	atrioventricular valve morphogenesis	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0030509	BMP signaling pathway	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0070724	BMP receptor complex	IDA	cellular component
GO:0032092	positive regulation of protein binding	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0039706	co-receptor binding	IPI	molecular function
GO:0039706	co-receptor binding	IPI	molecular function
GO:0071773	cellular response to BMP stimulus	IMP	biological process
GO:0046332	SMAD binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003308	negative regulation of Wnt signaling pathway involved in heart development	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0030501	positive regulation of bone mineralization	IDA	biological process
GO:0035630	bone mineralization involved in bone maturation	IDA	biological process
GO:0043569	negative regulation of insulin-like growth factor receptor signaling pathway	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0060317	cardiac epithelial to mesenchymal transition	IDA	biological process
GO:0060389	pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0060389	pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0071773	cellular response to BMP stimulus	IDA	biological process
GO:1901522	positive regulation of transcription from RNA polymerase II promoter involved in cellular response to chemical stimulus	IDA	biological process
GO:2000726	negative regulation of cardiac muscle cell differentiation	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IDA	biological process
GO:0030501	positive regulation of bone mineralization	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0001837	epithelial to mesenchymal transition	IDA	biological process
GO:0003130	BMP signaling pathway involved in heart induction	IDA	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	IDA	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0010894	negative regulation of steroid biosynthetic process	IDA	biological process
GO:0030509	BMP signaling pathway	IDA	biological process
GO:0030509	BMP signaling pathway	IDA	biological process
GO:0030509	BMP signaling pathway	IDA	biological process
GO:0032348	negative regulation of aldosterone biosynthetic process	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:2000065	negative regulation of cortisol biosynthetic process	IDA	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0003203	endocardial cushion morphogenesis	ISS	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IMP	biological process
GO:0030509	BMP signaling pathway	IMP	biological process
GO:0035051	cardiocyte differentiation	IMP	biological process
GO:0055007	cardiac muscle cell differentiation	IMP	biological process
GO:0060485	mesenchyme development	IMP	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0030509	BMP signaling pathway	IGI	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0060395	SMAD protein signal transduction	IDA	biological process
GO:0048762	mesenchymal cell differentiation	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0060804	positive regulation of Wnt signaling pathway by BMP signaling pathway	ISS	biological process
GO:0060128	corticotropin hormone secreting cell differentiation	ISS	biological process
GO:0060039	pericardium development	ISS	biological process
GO:0045666	positive regulation of neuron differentiation	ISS	biological process
GO:0035054	embryonic heart tube anterior/posterior pattern specification	ISS	biological process
GO:0033690	positive regulation of osteoblast proliferation	ISS	biological process
GO:0030335	positive regulation of cell migration	ISS	biological process
GO:0030177	positive regulation of Wnt signaling pathway	ISS	biological process
GO:0048839	inner ear development	ISS	biological process
GO:0042475	odontogenesis of dentin-containing tooth	ISS	biological process
GO:0021978	telencephalon regionalization	ISS	biological process
GO:0010862	positive regulation of pathway-restricted SMAD protein phosphorylation	IMP	biological process
GO:0007507	heart development	ISS	biological process
GO:0003181	atrioventricular valve morphogenesis	ISS	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	ISS	biological process
GO:0055008	cardiac muscle tissue morphogenesis	ISS	biological process
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0045165	cell fate commitment	ISS	biological process
GO:0009887	animal organ morphogenesis	ISS	biological process
GO:0007219	Notch signaling pathway	ISS	biological process
GO:0004745	retinol dehydrogenase activity	ISS	molecular function
GO:0001666	response to hypoxia	ISS	biological process
GO:0072138	mesenchymal cell proliferation involved in ureteric bud development	ISS	biological process
GO:0060129	thyroid-stimulating hormone-secreting cell differentiation	ISS	biological process
GO:0048711	positive regulation of astrocyte differentiation	ISS	biological process
GO:0042482	positive regulation of odontogenesis	ISS	biological process
GO:0030282	bone mineralization	ISS	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0003203	endocardial cushion morphogenesis	ISS	biological process
GO:0001701	in utero embryonic development	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04060	Cytokine-cytokine receptor interaction
hsa04390	Hippo signaling pathway
hsa04350	TGF-beta signaling pathway
hsa05217	Basal cell carcinoma

Diseases

Associated diseases	References
Brachydactyly	KEGG:H00482
Brachydactyly	KEGG:H00482
Tooth agenesis	PMID:23079991
Prostate cancer	PMID:15042598
Prostate cancer	PMID:17656261
Prostate cancer	PMID:16519147
Osteoporosis	PMID:17002564
otosclerosis	PMID:18021008
Osteoarthritis	PMID:15334463
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881